KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_0641Help
Entry
Rpdx1_0641        CDS       T01381                                 

Definition
malonyl-CoA decarboxylase (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
rpx  Rhodopseudomonas palustris DX-1
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpx00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Rpdx1_0641
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Rpdx1_0641
Enzymes [BR:rpx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     Rpdx1_0641
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(683351..684769)
Genome map
AA seq 472 aa AA seqDB search
MPTATVDRASEFLGGLFNSLTERGRSLFGRAGTQPMTKDELIGLGETLLSRRGEASGVAL
AASLLDGYEAAAEDDRLAFLDALAEQFGPDLADLNAAIEAFRADPTSEATGELMHAAEPR
RQELIRRLNHAPGGTAALVKMREAVLSHLRDHPQLRHVDDDFVHLFTSWFNRGFLVLQRI
DWTTPANILEKIIRYEQVHTIHDWDDLRARLAPPDRRCYGFFHPRLIDEPLIFVEVALTE
DSPAAIAPLLDLDREPMPASDATTAVFYSISNTQRGLAGISFGNFLIKQVVEEIKRELPN
VQTFVTLSPVPGFAKWLKRERDNPDSALLDASARDALEVLETENWFDDADTADRLRPIVM
QLAAAYFLQAKGPNGRPLDPVARFHLGNGARLDRLNFLGDRSPNGMRQSHGLMVNYLYAL
GDIEANHEALFERGQIAAASAVRKLVPTKPVTSEPRKSNGKTASAPQAAPTA
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgccgacagccaccgtagaccgcgcctcggagtttctcggcggcctgttcaacagcttg
accgagcgcggccgcagcctgttcggccgtgccggcactcagccgatgaccaaagacgaa
ctgatcgggctcggcgagacgctgctgtcccggcgcggtgaagcctccggagtcgcactg
gcggcatcgctactggacggctacgaggctgccgccgaggacgacaggctggcgtttctc
gatgcgctcgccgaacagttcgggcccgacctcgccgatctcaacgccgcgatcgaggcg
ttccgcgccgaccccacgtcggaggccaccggcgaactgatgcacgccgccgaaccgcgc
cggcaggagctgatccgccgcctcaaccatgcgccgggcggcaccgccgcgctggtgaag
atgcgcgaagcggtgctgtcgcatctgcgcgaccaccctcagcttcgccacgtcgacgac
gatttcgtgcatctgttcacctcgtggttcaaccggggcttcctcgtgctgcagcggatc
gactggaccacgccggccaatattctggaaaaaatcatccgctacgagcaggtccacacc
atccacgactgggacgatctgcgcgcacggctggcgcctcccgaccggcgttgctacggc
ttcttccatccgcgactgatcgacgagcctctgatcttcgtcgaggtcgcgctgaccgag
gacagtccggccgcgatcgcaccgctgctcgatctcgaccgcgagccgatgccggccagc
gacgccaccactgcggtgttctactcgatctccaacacccaacgaggtctcgccgggatc
tcgttcggcaatttcctgatcaagcaggtggtcgaggagatcaaacgcgaactgccgaac
gtgcagaccttcgtgacgctgtcgccggtgccgggcttcgccaaatggctgaaacgcgag
cgcgacaatccggactcggcgctgctcgatgcctccgcccgcgacgcgctcgaagtgctc
gaaaccgagaactggttcgacgatgcggacaccgccgatcggctgaggccgatcgtcatg
cagctcgcggcggcttacttcctgcaggccaagggtccgaatggccgtccgctcgatccg
gtggcgcgcttccatctcggcaacggcgcgcggctcgaccggctgaacttcctcggcgat
cgttcgccgaacggcatgcgccagtcgcacggcctgatggtcaactacctgtacgcactc
ggcgacatcgaggccaaccacgaggcgctgttcgaacgcggccagatcgccgccgcctcc
gcggtccgcaagctggtgccgaccaagccggtgaccagcgagccgcgcaagagcaacgga
aaaactgccagcgccccgcaggccgcgccgacggcgtga

DBGET integrated database retrieval system