KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_0698Help
Entry
Rpdx1_0698        CDS       T01381                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
rpx  Rhodopseudomonas palustris DX-1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rpx00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Rpdx1_0698
DNA repair and recombination proteins [BR:rpx03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Rpdx1_0698
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
747002..747607
Genome map
AA seq 201 aa AA seqDB search
MASSVAGPEIERLIQLLARLPGLGPRSARRAALHLIKKRDALMAPLSAALQVAIDKIQVC
TTCGNIDTQNPCTVCTDPRRDSSIIVVVADVADLWALERASATNGRYHVLGATLSPLDGV
GPDDLTIDALVKRAHDPGVAEIILALNATVDGQTTAHYVTDLLQDAGVKVTRLAHGVPVG
GELDYLDEGTLSAAMRQRTLF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggccagttcggtcgcaggccccgagatcgaacgtctgatccagttgctggcgcggctt
cccggattggggccgcggtcggcgcgccgcgccgcgctgcatctgatcaagaagcgcgac
gcgctgatggcgccgctctccgcggcgctccaggtcgcgatcgacaagatccaggtgtgt
acaacctgcggcaacatcgacacgcagaatccctgcacggtatgcactgatccgcggcgc
gattcctcgatcatcgtggtggtggccgacgtcgccgatctgtgggccctcgaacgcgcg
tccgccacaaacggccgataccacgttctcggcgcgacgctgtcgccgctcgacggcgtc
ggaccggatgatctgacgatcgacgctttggtgaagcgcgcgcacgatcccggcgtcgcc
gagatcatcctggcgctgaacgcgactgtcgacggccagaccaccgcacattacgtcacc
gaccttttgcaggacgcaggcgtcaaggtgacccggctggctcatggcgtgccggtcggc
ggtgaactcgactatctcgacgaaggaacgctgtcggcggcgatgcgacagcgtaccttg
ttctga

DBGET integrated database retrieval system