KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_0803Help
Entry
Rpdx1_0803        CDS       T01381                                 

Definition
sulfate adenylyltransferase large subunit (EC:2.7.1.25 2.7.7.4)
Orthology
K00955  
bifunctional enzyme CysN/CysC [EC:2.7.7.4 2.7.1.25]
Organism
rpx  Rhodopseudomonas palustris DX-1
Pathway
Purine metabolism
Selenocompound metabolism
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
Assimilatory sulfate reduction, sulfate => H2S
Sulfate-sulfur assimilation
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:rpx00920]
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:rpx00230]
Metabolism; Metabolism of other amino acids; Selenocompound metabolism [PATH:rpx00450]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
858401..860311
Genome map
AA seq 636 aa AA seqDB search
MTIAVPPASLAADAVRPLVRIVIVGHVDHGKSTLVGRLLHETGSLPEGKLEMLKAVSARR
GMPFEWSFLLDALQTERDQGITIDTTQIRFRTPSRDVVLIDAPGHAEFLRNMITGASQAD
GAVLIIDALEGVRDQTRRHGYLLQLLGIKQVAVVVNKMDRVEFSAARFNDISEEITAHLT
SLGVTPTAVIPISAREGDGVAARTANIAWYLGPTVVEALDGLTPAQPLDALPLRLAVQAI
YKFDDRRIVAGRIESGYLQAGDDIVIMPAGKIARIKTVEGWPVTPLAGSFGAGRSVGITL
DRELFVERGDVIGHAGTAPRDTRRLRARIFWLHDQPLTAGASVLVRLGTRETRANVVAIE
KAVDPGDLASEAASEIKRNHVGEIDLSLSQPVAADPADSNPRTGRLVIEINGRIAGGGLV
LSVDSGQRAATADIVPVESALLPGERAARYRHNGAVLWFTGLPGSGKSTLARALERRLFD
RGGSPILLDGDTLRAGLNNDLGFSPADRAENIRRLAELAAHLAANGHVAIVAAVSPALAD
RAAARRIAGDRFREIYVATSADVCEQRDPKGHYAKARAGGLPNFTGIGNDYQPPTASELV
LDTAGLSVSEAVGQVETMLAQTDVLIEDLADLAAHI
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcgccgttccgcccgcctcgctcgccgcagacgccgtccgtccgctggtgcgc
atcgtcatcgtcggccatgtcgaccacggcaagtcgacgctggtcggccgcctgctgcac
gaaaccggttcgctgcccgaaggcaagctcgagatgctgaaggcggtcagtgcccgccgc
ggcatgccgttcgagtggtcgttcctgctcgatgcgctgcagaccgagcgcgaccagggc
atcaccatcgacaccacccagatccgcttccgcacgccgtcgcgcgacgtggtgctgatc
gacgcgcccggccacgccgaattcctgcgcaacatgatcaccggcgcctcgcaggccgac
ggcgcggtgctgatcatcgacgcgctcgaaggcgtgcgcgatcagacccggcgtcacggc
tatctgctgcaactgctcggcatcaagcaggtcgccgtggtggtcaacaagatggaccgc
gtcgagttttcggcggcgcggttcaacgacatcagcgaagagatcaccgcgcatctgacc
tcgctcggtgtgacgccgaccgccgtgattccgatctcggcgcgcgagggcgacggcgtc
gccgcccgcaccgccaacatcgcctggtatctcggcccgaccgtggtcgaagcgcttgac
ggtttgacgccggcgcagccgctcgatgcgttgccgctgcggctcgccgtgcaggcgatc
tacaaattcgacgatcgccgcatcgtcgccggccgcatcgagtccggatatctgcaggcg
ggtgatgacatcgtcatcatgccggccggcaagatcgccaggatcaagaccgtcgaaggc
tggccggtgacgccactcgcaggttcgttcggcgccggccgttcggtcggcatcacgctc
gaccgcgagctgttcgtcgagcgcggcgacgtgatcggccatgccggcaccgcaccgcgc
gacacccgccggctccgcgcgcggattttctggctgcacgatcagccgctcaccgccggc
gcctcggtgctggtgcggctcggcacccgcgagacccgcgccaacgtcgtggcgatcgag
aaggcggtcgatcccggcgatctcgccagcgaggccgcatccgagatcaaacgcaaccat
gtcggcgaaatcgatctgtcgctgtcgcagccggtcgcggccgatccggccgatagcaat
ccgcgcaccgggcggctggtgatcgaaatcaacggccggatcgcgggcggcggtctggtg
ctcagcgtcgatagcggccagcgcgccgccactgccgatatcgtcccggtggagtccgcg
ctgctgccgggcgaacgcgccgcgcgctatcgccacaacggcgcggtgttgtggttcacc
gggctgccgggctccggcaagtcgacgctggcgcgtgcgctggagcggcgactgttcgat
cgcggcggctcgccgatcctgctcgacggcgacacgctacgcgccggactgaacaatgac
ctcggcttctcgccggcggatcgggcggagaacatccgccgcctcgccgagctcgccgcg
catctggccgccaatggccatgttgcgatcgttgcggcagtatcgccggcgctcgccgac
cgcgccgcggcacggcgcatcgccggtgatcgcttccgcgagatctatgtcgcgacctcg
gctgacgtctgcgagcagcgcgacccgaaggggcactacgccaaggcgcgtgccggcggg
ttgccgaacttcaccggcatcggcaacgactatcagccgccgaccgccagcgaactggtg
ctcgacaccgcgggtctgtcggtcagcgaagccgtggggcaggtagagacaatgctggcg
cagaccgacgtgctgatcgaagacctggccgacctcgcggcgcacatctga

DBGET integrated database retrieval system