KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_0979Help
Entry
Rpdx1_0979        CDS       T01381                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase NAD-binding protein
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
rpx  Rhodopseudomonas palustris DX-1
Pathway
rpx00071  Fatty acid degradation
rpx00280  Valine, leucine and isoleucine degradation
rpx00281  Geraniol degradation
rpx00310  Lysine degradation
rpx00362  Benzoate degradation
rpx00380  Tryptophan metabolism
rpx00410  beta-Alanine metabolism
rpx00640  Propanoate metabolism
rpx00650  Butanoate metabolism
rpx00903  Limonene and pinene degradation
rpx00930  Caprolactam degradation
rpx01040  Biosynthesis of unsaturated fatty acids
rpx01100  Metabolic pathways
rpx01110  Biosynthesis of secondary metabolites
rpx01120  Microbial metabolism in diverse environments
rpx01130  Biosynthesis of antibiotics
rpx01200  Carbon metabolism
rpx01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rpx00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Rpdx1_0979
   00650 Butanoate metabolism
    Rpdx1_0979
  Lipid metabolism
   00071 Fatty acid degradation
    Rpdx1_0979
   01040 Biosynthesis of unsaturated fatty acids
    Rpdx1_0979
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rpdx1_0979
   00310 Lysine degradation
    Rpdx1_0979
   00380 Tryptophan metabolism
    Rpdx1_0979
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Rpdx1_0979
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Rpdx1_0979
   00281 Geraniol degradation
    Rpdx1_0979
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rpdx1_0979
   00930 Caprolactam degradation
    Rpdx1_0979
Enzymes [BR:rpx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Rpdx1_0979
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Rpdx1_0979
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Rpdx1_0979
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 ECH_2 3HCDH UDPG_MGDP_dh_N FAD_binding_3 NAD_binding_2 DAO F420_oxidored GIDA Pyr_redox_2 ApbA NAD_binding_8 NAD_Gly3P_dh_N 2-Hacid_dh_C NAD_binding_7 AlaDh_PNT_C Rib_5-P_isom_A Pyr_redox Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ADU42606
JGI: Rpdx1_0979
UniProt: E6VBN4
Position
1047396..1049612
Genome map
AA seq 738 aa AA seqDB search
MTFKNFKVDTDADGIALVTWDLPGKSMNVLDATTIEELGAIAEQTSKDAAVKGVVITSAK
EAFCAGADLSMLEGMNQQFAQIRKEKGEEAAQKMLFDESRKLSQILRGIETCGKPWVAAI
NGLALGGGFEVTLACHYRVAADNPKTRLGLPEIKVGLFPGGGGTQRIPRIVDPQSAMTIL
LKGDQIKLDKAKALKLVDAVVPAADLIKTAKDWIKGGGKAVAPWDEKGFKLPGGPVFSKQ
GMMMFPAGNAIYRRETYDNYPAARAIMSCVYEGLLVPMDVALRIESRYFAHVLQTKEAAA
MIRSLFLSMQELNKGARRPQGVPPTKVKKLAIIGAGFMGASVGYVSAKAGIEVVLIDRDQ
ESADKGKAHCQSVIEGLIKKGRAKEADRDALMSRITATADFNAISDADLVIEAVFEDRKV
KAETYAKAQPLLKEGAIFASNTSTLPINSLAEEFKDQSKFIGIHFFSPVEKMMLVEVILG
NNTSDATLAAALDYTRQIGKTPIVVNDSRGFFANRCVLRFTAEGLEMLMEGVPAPMIETA
AKMAGMPVGPLSLADEVALDLILKIMKATEADLGEQAVDQQQKKLMVELVEKQGRFGRKN
GKGFYVYPEKGKGQKSLWDGIAALQPKHLDPDTIDVEELKQRFLAVQAVEAARTVEDNVI
VDPREADVGSILGFGFAPFTGGTLSYIDFMGTKEFVALCHKLEGKYGSRFTPPKLLEDMA
KTGDTFYHRFAPKKQAAA
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgaccttcaagaacttcaaagtcgacaccgacgccgacggcattgcgctcgtcacctgg
gatctgcccggcaagtcgatgaacgtgctcgacgccacgacgatcgaggaactcggcgcg
atcgccgagcagaccagtaaggacgccgcggtcaagggcgtggtgatcacttcggccaag
gaggcgttctgcgccggcgccgatctgtcgatgctggaaggcatgaaccagcagttcgcc
cagatccggaaggagaagggcgaggaagccgcccagaagatgctgttcgacgagagccgc
aagctgtcgcagatcctgcgcggcatcgagacctgcggcaagccgtgggtcgcggcgatc
aacggtctggcgctcggcggcggcttcgaagtgacgctggcctgccactatcgcgtcgca
gccgacaatccgaagacccggctcggcctgcccgagatcaaggtcggcctgttcccgggc
ggcggcggcacccagcggattccgcgcattgtcgatccgcagagcgcgatgaccatcctg
ctcaagggcgatcagatcaagctcgacaaggccaaggcgctgaagctggtcgacgcggtg
gtgccggcggccgatctgatcaagaccgccaaggactggatcaagggcggcggcaaggcg
gtggcgccgtgggacgagaagggcttcaagctgcccggcggcccggtgttctccaagcag
ggcatgatgatgttcccggccggcaacgccatctatcgtcgcgagacctacgacaactat
ccggcggcccgcgcgatcatgagctgcgtctatgagggcctgttggtgccgatggacgtc
gcgctgcgcatcgagtcgcgctacttcgcgcacgtcctgcagaccaaggaagcggcggcg
atgatccgcagcctgttcctgtcgatgcaggagctgaacaagggcgcgcgccgcccgcag
ggcgtgccgccgaccaaggtcaagaagctcgccatcatcggcgccggcttcatgggcgcc
agcgtcggctacgtctcggccaaggccggcatcgaggtggtgctgatcgatcgcgaccag
gagagcgccgacaagggcaaggcgcattgccagtcggtgatcgaaggtctcatcaagaag
ggccgcgccaaggaggccgaccgtgacgcgctgatgtcgcggatcaccgcgaccgccgac
ttcaatgcgatttcggatgccgacctcgtcatcgaagcggtgttcgaggatcgcaaggtc
aaggccgagacctacgccaaggcgcagccgctgctgaaggaaggcgcgatcttcgcctcc
aacacctcgacgctgccgatcaactcgctggccgaagagttcaaggatcagtcgaagttc
atcggcatccacttcttctcgccggtcgagaagatgatgctggtcgaagtgatcctcggc
aacaacaccagcgacgccacgctggcggcagcgctggactacacccggcagatcggcaag
accccgatcgtggtcaacgacagccgcggcttcttcgccaaccgttgtgtgctgcgtttc
accgccgaaggcctcgagatgctgatggaaggcgtcccggcgccgatgatcgagaccgcc
gccaagatggccggcatgccggtcggcccgctgtcgctggccgacgaagtcgcgctcgac
ctgatcctgaagatcatgaaggcgaccgaagccgacctcggcgaacaggcggtcgatcag
cagcagaagaagctgatggtcgagctggtcgagaagcagggccggttcggccgcaagaat
ggcaagggcttctacgtctatccggagaagggcaagggtcagaagagcctgtgggacggc
atcgccgcgctgcagcccaagcacctcgaccccgacaccatcgacgtcgaagagctgaag
cagcgcttcctcgccgtccaggcggtggaagcggcgcgcaccgtcgaggacaacgtcatc
gtcgatccgcgcgaggccgatgtcggctcgatcctcggcttcggcttcgcgccgttcacc
ggcggcacgctcagctacatcgacttcatgggtaccaaggagttcgtggcgctgtgccac
aagctcgagggcaaatacggctcgcgcttcaccccgccgaagctgctcgaagacatggcc
aagaccggcgacaccttctaccaccgcttcgccccgaagaagcaggcggcggcgtaa

DBGET integrated database retrieval system