KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_0979Help
Entry
Rpdx1_0979        CDS       T01381                                 

Definition
NAD-binding 3-hydroxyacyl-CoA dehydrogenase protein
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
rpx  Rhodopseudomonas palustris DX-1
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rpx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rpdx1_0979
   01212 Fatty acid metabolism
    Rpdx1_0979
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Rpdx1_0979
   00650 Butanoate metabolism
    Rpdx1_0979
  Lipid metabolism
   00071 Fatty acid degradation
    Rpdx1_0979
   01040 Biosynthesis of unsaturated fatty acids
    Rpdx1_0979
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rpdx1_0979
   00310 Lysine degradation
    Rpdx1_0979
   00380 Tryptophan metabolism
    Rpdx1_0979
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Rpdx1_0979
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Rpdx1_0979
   00281 Geraniol degradation
    Rpdx1_0979
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Rpdx1_0979
Enzymes [BR:rpx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Rpdx1_0979
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Rpdx1_0979
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Rpdx1_0979
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1047396..1049612
Genome map
AA seq 738 aa AA seqDB search
MTFKNFKVDTDADGIALVTWDLPGKSMNVLDATTIEELGAIAEQTSKDAAVKGVVITSAK
EAFCAGADLSMLEGMNQQFAQIRKEKGEEAAQKMLFDESRKLSQILRGIETCGKPWVAAI
NGLALGGGFEVTLACHYRVAADNPKTRLGLPEIKVGLFPGGGGTQRIPRIVDPQSAMTIL
LKGDQIKLDKAKALKLVDAVVPAADLIKTAKDWIKGGGKAVAPWDEKGFKLPGGPVFSKQ
GMMMFPAGNAIYRRETYDNYPAARAIMSCVYEGLLVPMDVALRIESRYFAHVLQTKEAAA
MIRSLFLSMQELNKGARRPQGVPPTKVKKLAIIGAGFMGASVGYVSAKAGIEVVLIDRDQ
ESADKGKAHCQSVIEGLIKKGRAKEADRDALMSRITATADFNAISDADLVIEAVFEDRKV
KAETYAKAQPLLKEGAIFASNTSTLPINSLAEEFKDQSKFIGIHFFSPVEKMMLVEVILG
NNTSDATLAAALDYTRQIGKTPIVVNDSRGFFANRCVLRFTAEGLEMLMEGVPAPMIETA
AKMAGMPVGPLSLADEVALDLILKIMKATEADLGEQAVDQQQKKLMVELVEKQGRFGRKN
GKGFYVYPEKGKGQKSLWDGIAALQPKHLDPDTIDVEELKQRFLAVQAVEAARTVEDNVI
VDPREADVGSILGFGFAPFTGGTLSYIDFMGTKEFVALCHKLEGKYGSRFTPPKLLEDMA
KTGDTFYHRFAPKKQAAA
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgaccttcaagaacttcaaagtcgacaccgacgccgacggcattgcgctcgtcacctgg
gatctgcccggcaagtcgatgaacgtgctcgacgccacgacgatcgaggaactcggcgcg
atcgccgagcagaccagtaaggacgccgcggtcaagggcgtggtgatcacttcggccaag
gaggcgttctgcgccggcgccgatctgtcgatgctggaaggcatgaaccagcagttcgcc
cagatccggaaggagaagggcgaggaagccgcccagaagatgctgttcgacgagagccgc
aagctgtcgcagatcctgcgcggcatcgagacctgcggcaagccgtgggtcgcggcgatc
aacggtctggcgctcggcggcggcttcgaagtgacgctggcctgccactatcgcgtcgca
gccgacaatccgaagacccggctcggcctgcccgagatcaaggtcggcctgttcccgggc
ggcggcggcacccagcggattccgcgcattgtcgatccgcagagcgcgatgaccatcctg
ctcaagggcgatcagatcaagctcgacaaggccaaggcgctgaagctggtcgacgcggtg
gtgccggcggccgatctgatcaagaccgccaaggactggatcaagggcggcggcaaggcg
gtggcgccgtgggacgagaagggcttcaagctgcccggcggcccggtgttctccaagcag
ggcatgatgatgttcccggccggcaacgccatctatcgtcgcgagacctacgacaactat
ccggcggcccgcgcgatcatgagctgcgtctatgagggcctgttggtgccgatggacgtc
gcgctgcgcatcgagtcgcgctacttcgcgcacgtcctgcagaccaaggaagcggcggcg
atgatccgcagcctgttcctgtcgatgcaggagctgaacaagggcgcgcgccgcccgcag
ggcgtgccgccgaccaaggtcaagaagctcgccatcatcggcgccggcttcatgggcgcc
agcgtcggctacgtctcggccaaggccggcatcgaggtggtgctgatcgatcgcgaccag
gagagcgccgacaagggcaaggcgcattgccagtcggtgatcgaaggtctcatcaagaag
ggccgcgccaaggaggccgaccgtgacgcgctgatgtcgcggatcaccgcgaccgccgac
ttcaatgcgatttcggatgccgacctcgtcatcgaagcggtgttcgaggatcgcaaggtc
aaggccgagacctacgccaaggcgcagccgctgctgaaggaaggcgcgatcttcgcctcc
aacacctcgacgctgccgatcaactcgctggccgaagagttcaaggatcagtcgaagttc
atcggcatccacttcttctcgccggtcgagaagatgatgctggtcgaagtgatcctcggc
aacaacaccagcgacgccacgctggcggcagcgctggactacacccggcagatcggcaag
accccgatcgtggtcaacgacagccgcggcttcttcgccaaccgttgtgtgctgcgtttc
accgccgaaggcctcgagatgctgatggaaggcgtcccggcgccgatgatcgagaccgcc
gccaagatggccggcatgccggtcggcccgctgtcgctggccgacgaagtcgcgctcgac
ctgatcctgaagatcatgaaggcgaccgaagccgacctcggcgaacaggcggtcgatcag
cagcagaagaagctgatggtcgagctggtcgagaagcagggccggttcggccgcaagaat
ggcaagggcttctacgtctatccggagaagggcaagggtcagaagagcctgtgggacggc
atcgccgcgctgcagcccaagcacctcgaccccgacaccatcgacgtcgaagagctgaag
cagcgcttcctcgccgtccaggcggtggaagcggcgcgcaccgtcgaggacaacgtcatc
gtcgatccgcgcgaggccgatgtcggctcgatcctcggcttcggcttcgcgccgttcacc
ggcggcacgctcagctacatcgacttcatgggtaccaaggagttcgtggcgctgtgccac
aagctcgagggcaaatacggctcgcgcttcaccccgccgaagctgctcgaagacatggcc
aagaccggcgacaccttctaccaccgcttcgccccgaagaagcaggcggcggcgtaa

DBGET integrated database retrieval system