KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_1006Help
Entry
Rpdx1_1006        CDS       T01381                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
rpx  Rhodopseudomonas palustris DX-1
Pathway
rpx00260  Glycine, serine and threonine metabolism
rpx00750  Vitamin B6 metabolism
rpx01100  Metabolic pathways
rpx01110  Biosynthesis of secondary metabolites
rpx01120  Microbial metabolism in diverse environments
rpx01230  Biosynthesis of amino acids
Module
rpx_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rpx00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rpdx1_1006
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Rpdx1_1006
Enzymes [BR:rpx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Rpdx1_1006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP GAF_2
Motif
Other DBs
NCBI-ProteinID: ADU42632
JGI: Rpdx1_1006
UniProt: E6VBR0
Position
1069105..1070523
Genome map
AA seq 472 aa AA seqDB search
MTTYVSTRGDAPRLGFCDVMLTGLARDGGLYIPEVWPQLTPDTITSLFGRPYWEVAVEVI
RPFVAGEISDAQLGRMANEAYATFRHPAVVPLRQTGPSQFVLELFHGPTLAFKDVAMQLL
SRLMDHVLEKRKQRTTIVVATSGDTGGAAVDAFANLNNVDLVVLFPHGRISDVQRMMMTT
SGASNVHPLAIEGHFDDCQAIVKALFNHHKFRDQVALSGVNSINWARIVAQVVYYFTSAV
ALGAPNRLVDFTVPTGNFGDIFAGYVAKKMGLPVRRLKIAANVNDILVRTLKTGIYEVRE
VHATRSPSMDIQVSSNFERLLFEASGRDAALIRSLMGSLHQSGRFVLPDAVLAAIRDEFD
AGRADEAETESAIRAAWREAGDLIDPHTAVALAVADRDTTDSTVPNIVLSTAHAAKFPDA
VEAACGIRPELPAWLDGLMSKPESIKIMPRDPVAIERHVLAVSRAAKQGAAG
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
ttgacgacctatgtttcgacccggggcgatgccccgcgcctcggcttttgcgacgtgatg
ctgaccgggctcgcccgcgacggcgggctttacatccctgaagtctggccgcagctcacc
cccgacaccatcaccagcctgttcggccggccgtattgggaggtcgccgtcgaggtgatc
cggccgttcgtcgccggcgagatttccgacgcccaactcggccgcatggccaacgaggcc
tacgccaccttccgccatcccgcggtggtgccgctgcgccagaccggcccgagccagttc
gtgctcgagctgttccacggcccgacgctggcgttcaaggacgtcgcgatgcagcttctg
tcgcggctgatggatcacgtgctggagaaacgcaagcagcgcaccaccatcgtggtggcg
acctccggcgacaccggcggtgccgcggtcgacgccttcgccaacctgaacaatgtcgac
ctcgtcgtgctgtttccgcacggccggatctccgacgtgcagcggatgatgatgacgacg
tccggcgcgtcgaacgtgcatccgttggcgatcgaaggccatttcgacgattgtcaggcg
atcgtgaaggcgctgttcaatcaccacaaattccgcgatcaggtggcgctgtccggcgtc
aattcgatcaattgggcgcggatcgtcgcgcaggtggtgtactatttcaccagcgcggtg
gcgctcggcgcgcccaaccggctggtcgacttcaccgtgccgaccggcaatttcggcgac
atcttcgccggctacgtcgccaagaagatgggcctgccggtacgccggctgaagatcgcc
gccaacgtcaacgacattctcgtccgcaccctgaagaccgggatctacgaggtccgcgag
gttcatgccacccgttcgccgtcgatggacatccaggtgtcgtcgaatttcgagcgattg
ctgttcgaagcctccggccgcgacgccgcgctgattcgctcgctgatgggctcgctgcat
cagtccggccgcttcgtgctgccggatgcggtgctggccgcgatccgcgacgaattcgat
gccggccgcgccgacgaggcggaaaccgaatccgcgattcgtgccgcttggcgcgaggcc
ggtgacctgatcgacccgcacaccgcggtggcgctggcggtggccgaccgcgacaccacc
gattcgaccgtgccgaacatcgtgctgtcgactgcccacgccgcaaagttcccggacgcg
gtcgaagccgcctgcggcatccggccggagctgccggcctggctcgacgggctgatgagc
aagccggaatcgatcaagatcatgccgcgcgatccggtcgcgatcgaacgtcacgtgctg
gcggtcagccgtgccgccaagcaaggagcagccggatga

DBGET integrated database retrieval system