KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_1051Help
Entry
Rpdx1_1051        CDS       T01381                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
rpx  Rhodopseudomonas palustris DX-1
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:rpx00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Rpdx1_1051
Enzymes [BR:rpx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Rpdx1_1051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1117753..1118697)
Genome map
AA seq 314 aa AA seqDB search
MTLVSTPANPVPENAVSGFIKTPDGVSLRFARWEPPGHRKGTVCVFTGRTEQIEKYFETV
RDLRDRGFAVAALDWRGQGHSERRLRDYRKGYVRNFADFEVDVETFVRDVVLPDCPPPHF
ALAHSMGGAVMLRIARSGKRWFDRMVLSAPMIDLAGNTTALPIRLLLRAMRLAGQGGRYV
PGGNDVLANTEPFVGNKLTSDPVRYARNAAIVVEDPTLGLASPTVAWADTAFRAMHAFKA
TDYPSQIRQPILITAAGMDSVVSTPAIEEFAYHLRAGSHLVIPGAKHEILQEQDRYRQQF
WAAFDAFVPGTPLF
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgacgctcgtctcgactcctgccaatccggtgcccgaaaacgccgtctccggtttcatc
aagacgcccgacggggtgagcttgcggttcgcgcggtgggagccgccggggcatcgcaag
ggtaccgtgtgcgtcttcaccggacgcaccgagcagatcgaaaagtacttcgaaacggtg
cgcgacctgcgcgatcgcggctttgcggtggcggcgctcgactggcgcggccagggccat
tcggaacgacggctgcgcgactatcgcaagggctatgtacgcaacttcgccgacttcgag
gtcgacgtcgaaaccttcgtccgcgacgtggtgctgccggactgcccaccgccgcatttc
gcgctggcgcattcgatgggcggagcggtgatgctgcgaatcgcgcgctccggcaagcgc
tggttcgaccgcatggtgctgtcggccccgatgatcgacctcgccggcaacaccaccgca
ctgccgatcaggctgctgctgcgcgcgatgcggctggccggccagggcggccgctacgtc
cccggcggcaacgacgtgctcgccaataccgagccgttcgtcggcaacaagctgacctcg
gacccggtgcgctacgcccgcaacgccgcgatcgtcgtcgaagacccgacgctgggcctc
gcctcgccgaccgtggcctgggccgacaccgcgttccgcgcgatgcacgccttcaaggcc
accgactacccgtcgcagatccggcagccgatcctgataaccgccgccggcatggacagc
gtggtttcgactcccgcgatcgaggagttcgcctatcatttgcgtgccggttcgcatttg
gtgatccccggcgccaagcacgaaatcctgcaggagcaggatcgttaccgccagcagttc
tgggccgcgttcgatgctttcgtaccggggacgccgctgttctga

DBGET integrated database retrieval system