KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_1267Help
Entry
Rpdx1_1267        CDS       T01381                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
rpx  Rhodopseudomonas palustris DX-1
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:rpx03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1347661..1348278
Genome map
AA seq 205 aa AA seqDB search
MIGKLKGVIDSYGEDYVILDVHGVGYQVHCASRTLQALPSPGEAATLSIETYVREDQIKL
FGFRTDTEREWFRLLQTVQSVGAKVALAVLSTLPPHDLANAIALRDKAAVARTPGVGPKV
AERIVTELKDKVPALSNVDPAVVHLSGAIDDNTAPRAVADAISALVNLGYGQPQAAAAVA
AASRSAGEDAATAQLIKLGLKELSK
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgatcggcaagctcaagggcgtcatcgattcctacggcgaggactacgtcatcctcgac
gtccacggcgtcggctatcaggtgcattgcgccagccgcaccttgcaggcgctgccgtcg
ccgggcgaggcagcgacgttgtcgatcgagacctatgtgcgcgaggatcagatcaagctg
ttcggctttcgcaccgacaccgagcgcgagtggttccgcctgctgcagaccgtgcagagc
gtcggcgccaaggtggcgctggcggtgctctcgacgttgccgccgcacgacctcgccaac
gcgatcgcgctgcgcgacaaggccgcggtggcgcgtacgcccggcgtcgggccgaaggtc
gccgagcgcatcgtcaccgagctgaaggacaaggtgccggcgctgtcgaacgtcgatccg
gcggtggtgcatctgtccggcgcgatcgacgacaacaccgcgccgcgcgccgtcgccgac
gcgatctctgcgctggtcaatctcggctacggccagccgcaggcggcggccgctgtcgct
gcggcgtcgcgcagtgccggcgaggacgccgcgaccgcgcaactgatcaagctcggcctg
aaggagctgtcgaagtga

DBGET integrated database retrieval system