KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_1646Help
Entry
Rpdx1_1646        CDS       T01381                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
rpx  Rhodopseudomonas palustris DX-1
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpx00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Rpdx1_1646
Enzymes [BR:rpx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Rpdx1_1646
Exosome [BR:rpx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rpdx1_1646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1751167..1752669
Genome map
AA seq 500 aa AA seqDB search
MPFVMAIDQGTTSSRAILFRSDISIAASAQQEFPQHFPASGWVEHEPEDIWATTIATCRA
AMHKAGASAADIAAIGITNQRETVVVWDAVSGQAIHRAIVWQDRRTAEFCTRLKAEGLEP
MVTAKTGLIIDPYFSGTKVAWLLDNVPGARARAERGELKFGTVDCYLLWRLTGGKVHATD
ATNASRTLLFNIHDGAWDDELLKLLGVPRSMLPEVKDSSAHFGDSVPELFGGSITIRGIA
GDQQAATIGQACFTPGMIKSTYGTGCFALLNTGATPVKSNNKLLTTVAYQLDGKRTYALE
GSIFVAGSAVQWLRDGLGVIKHASETGPLADKSDSAQSVYLVPAFVGMGAPYWNPRVRGA
LFGLTRNTGPAELAHAALESVCYQTFDLWAAMRADWPDADAATTVLRVDGGMTASDWTMQ
RLADLLDAPVDRPVIQETTALGAAYLAGLSAGVFPEPQKFADNWRLDHRFRPAMSAATRE
RKLAGWARAVKGLLATDEGE
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgcctttcgtcatggccatcgatcagggcaccacctcgtcgcgggcgattctgttccgc
tccgacatttcgatcgcggcctccgcgcagcaggaattcccgcagcatttcccggcgtcc
ggctgggtcgagcacgagcccgaggatatctgggcgaccaccatcgccacctgccgcgcc
gcgatgcacaaggccggcgccagcgccgccgacatcgccgcgatcggcatcaccaatcag
cgcgaaaccgtggtggtgtgggatgccgtctcaggccaggcgatccaccgcgccatcgtc
tggcaggaccgccgcaccgcggagttctgcacccggctgaaggccgaggggctggagccg
atggtcaccgccaagaccgggctgatcatcgatccgtatttctccggcaccaaggtcgcc
tggctgctcgacaacgtgcccggcgcgcgggcccgcgccgaacgcggcgagctgaagttc
ggcaccgtcgactgctatctgctgtggcggctgaccggcggcaaggtccacgccaccgac
gctaccaatgcgtcgcgcacgctgctgttcaacatccatgacggcgcctgggacgacgag
cttctcaagttgctcggcgtgccgcgctcgatgttgccggaggtgaaggattcctcggcg
catttcggcgacagcgtgccggagctgttcggcggctcgatcaccatccgcggcatcgcc
ggcgaccagcaagcggcgaccatcggccaggcttgcttcaccccgggcatgatcaagtcg
acctacggcaccggctgcttcgcgctgctcaacaccggtgcgacgccggtgaagtcgaac
aacaagctgctcaccaccgtcgcctatcagctcgacggcaagcgcacctacgcgctggaa
ggctcgatcttcgtcgccggcagcgcggtgcagtggctgcgcgacggcctcggcgtgatc
aagcatgcctccgagaccgggccgctcgccgacaagtcggattcggcgcagagcgtgtat
ctggtcccggcgttcgtcggcatgggcgcgccgtattggaatccgcgcgtgcgcggcgcg
ctgttcggcttgacgcgcaacaccggcccagccgagcttgcccacgcggcgctggagagc
gtgtgctaccagaccttcgacctgtgggcggcgatgcgcgccgactggccggatgccgat
gctgccaccaccgtgctccgcgtcgacggcggcatgaccgcctccgactggaccatgcag
cgcctcgccgatctgctcgacgccccggtcgaccgcccggtgatccaggaaaccaccgcg
ctcggcgccgcctacctcgccggcctcagtgcaggcgtcttccccgagccacaaaaattc
gccgacaactggcgcctcgaccaccgcttccgccccgccatgagcgcggcgacgcgcgaa
cgcaaattggcgggctgggcgagagcggtgaaggggctgctggcgacggacgagggggag
taa

DBGET integrated database retrieval system