KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_1710Help
Entry
Rpdx1_1710        CDS       T01381                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
rpx  Rhodopseudomonas palustris DX-1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpx00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Rpdx1_1710
Enzymes [BR:rpx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Rpdx1_1710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1827141..1829099
Genome map
AA seq 652 aa AA seqDB search
MDLFTRASELGIQTEFYDGQGRRHVTPPEALALITEAMPQPAERRLLDRIVVIREGEPCR
SELGAQAVLPVRWRIVTDGGALVEGVADQRTLSWPQDLPLGIHRVRLSDASGRTEELPLL
MAPRRAFGGAFDRSWLIAVQLYSLRSVRNWGIGDFTDLANLIELAAALGAGGIGLNPLHA
LFDDRPGDCSPYSPNSRLFLNPLYVDVERLPEFSAADRPVDAQTLAALRDGELIDYAAVA
AVKWRGLRAAYEAFRTSASDSRREAFEAFRRERAPLLTRFACFEVLRHRFGHPWWEWPEE
WRQPDDARCDLLRQGPDAAEVEFVAFTQWCADDQLRGCRDLAAARGMSVGLYLDVAVGVQ
SDGFDAWNEQTAISRLLSVGAPPDSLNTAGQNWGLAGFNAPGLELTGFAPFRDMLRASMR
YAGAIRLDHVLGLNRLYLVPHGFAAHEGVYVQMPFEALLAVTAQESVGHRCVVIGEDLGT
VPDGFRDRLAAWGIWSYRVMMFERDFHQGWFFGLEHYLPNALVTFNTHDLATYSGWRALT
DLHLKRSIGVDPGESDDSRHHALAMLGDALRHQGIEHEDIYAVLTFLARTPSRLLAIALE
DLLGVLDQPNVPGTVSEHPNWRRRLPKPLEDVAAIINRSALFAATIDRRNPG
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atggatttattcaccagagcttccgagctgggcatccagaccgaattctacgacggtcag
ggacgccgccacgtcaccccgccagaggcattggcgctgataaccgaggcgatgccgcag
cccgccgagcgcaggttgttggaccggatcgtggtgatccgggagggcgagccgtgtcgc
tccgagctgggcgcccaggcggtgctgcctgtacgttggcgtatcgtcaccgatgggggc
gcgctggttgaaggcgtcgccgatcagcggaccctgagctggccgcaggatctgccgctc
ggcattcaccgcgtgcggctgagcgacgcatccggccgcaccgaggagctgccgctgctg
atggcgccgcggcgcgccttcggcggtgcgttcgaccgctcgtggctgatcgcggttcag
ctctacagcctgcgatcggtacgcaattggggcatcggcgatttcaccgatctggccaac
ctgatcgagctcgcggccgcgctgggggcaggcgggatcggtctcaatccgctgcatgcg
ttgttcgacgaccggccgggggattgcagcccttattcgccgaacagccggctgttcctc
aatccgttgtatgtcgatgtcgaacggctgccggagttttccgccgccgaccggccggtc
gacgcccagacgctggcggcgctccgcgacggcgagctgatcgactacgccgcggtggcg
gccgtgaagtggcggggtctgcgggccgcctatgaggcgttccggacctcggcgtccgac
agccggcgcgaagcgttcgaggcattccgccgcgagcgcgcgccgctgctgacgcggttc
gcgtgtttcgaagttctgcggcaccggttcgggcatccatggtgggaatggccggaagaa
tggcgccagcccgacgatgcccgctgcgatctattgcgacagggccccgatgccgccgag
gtggaattcgtcgccttcacccaatggtgcgccgatgatcagttgcgcggctgccgcgat
ctcgccgcagcgcgcggcatgagcgtagggctgtatctcgacgtcgcggtcggagtgcag
agcgacggcttcgacgcctggaacgagcagaccgcgatctcgcggctgctgtcggtcggc
gcgccgccggactcgctcaacaccgcgggtcagaattggggcctggccggcttcaacgcg
ccagggctggaactgacgggctttgcgccgttccgcgacatgctgcgggcctcgatgcgc
tatgctggcgcgatccggctcgatcacgtgctcgggctcaatcggctgtatctcgtcccg
catggcttcgccgcccatgagggcgtctacgtgcagatgccgttcgaggcgctgctcgcg
gtcaccgcgcaggagagcgtcggacatcgctgcgtggtgatcggcgaggacctcggtacc
gttccggacggcttccgcgatcggctggcggcgtgggggatctggtcgtaccgggtgatg
atgttcgaacgcgacttccaccagggctggttcttcgggctcgagcactacctgccgaat
gcgctggtgaccttcaacacccacgatctcgccacctattcgggttggcgcgcgctcaca
gacctgcatctgaagcgctcgatcggggtcgaccccggcgagagcgacgacagccggcac
cacgcgctggcgatgctcggcgacgccctgcgccatcagggcatcgaacacgaggacatc
tacgcggtgctgaccttcctggcgcgtacgccgtcgcgcctgctggcgatcgcgctggaa
gatctgctgggggtgctcgaccagcccaatgtgccggggacggtgtcggaacatccgaat
tggcgacggcggttgccgaagccgctcgaagacgtcgccgccatcatcaaccgctcggca
cttttcgcggcgacgatcgaccgccgcaatccgggttga

DBGET integrated database retrieval system