KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_1817Help
Entry
Rpdx1_1817        CDS       T01381                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
rpx  Rhodopseudomonas palustris DX-1
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:rpx00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:rpx00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1933756..1935213
Genome map
AA seq 485 aa AA seqDB search
MKLRDLFSAETEIAASAADRPIGGLAVDSRAVRPGDLFFALAGAKTDGARFVAAAIAAGA
VAVAGEHPPAGDLAVPFVQLSNPRLALAQAAARFYPRQPEVIAAVTGTSGKTSVAAFTRQ
IWQRLGHASASIGTIGLVTPTRSVYGSLTTPDPIALHRSLDEIAGEGITHLALEASSHGL
DQFRLDGVRVAAGGFTNLSRDHMDYHPTVAHYLNAKLRLFRHLVQDGGAAVIAADHDCSA
EVIEAAGARGLRLITIGRNGDPGEGIALIDAAIDGFAQILTVAHAGRRYSIKLPLVGEFQ
IENALVAAGLVIGTGGDSAASFAALEHLEGAPGRLDLVGAHRGAPVFVDYAHKPDALAKS
LQALRPYAKRKLVVVFGAGGDRDAGKRPLMGAIAAEHADTVIVTDDNPRSEDPAAIRAAI
LAAAPGARAIGDRAEAIRTAIGELQPGDALVIAGKGHETGQIVGDRVLPFSDHDAAKAAL
SASAA
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaagctccgcgacctgttcagcgccgaaaccgagatcgccgcgtcggcggccgaccgc
cccatcggcggactcgccgtcgacagccgcgcggtgcggccgggtgatctgttcttcgcg
ctcgccggtgcgaagaccgacggcgcgcggttcgtcgccgcggcgatcgccgcgggggcc
gtggcggtcgcaggcgagcatccgccggccggcgatctcgcagtaccgttcgtacagctc
tcgaacccgcgactggcgctggcgcaggccgcggcgcgattctatccgcggcagccggag
gtgatcgccgcggtcaccggcaccagcggcaagacctcggttgcggccttcacccggcag
atctggcagcggctcggccatgcctccgccagcatcggcaccatcgggctggtgacgccg
acgcgcagcgtttacggctcgctgaccacgccggacccgatcgcgctgcatcgctcgctg
gacgagatcgcgggcgagggcatcacccatctggcgctggaggcgtcgtcgcacgggctc
gatcagttccggctcgacggcgtccgcgtcgccgccggcggcttcaccaacctgtcgcgc
gaccatatggattatcaccccacggtcgcgcactatctgaatgccaagctgcggctgttc
cgccacctggtgcaggacggcggcgccgcggtgatcgccgccgatcacgactgctcggca
gaggtgatcgaggcggccggggcgcgcggcctgcggctgatcaccatcggtcgcaacggc
gatccgggcgaggggatcgcgctgatcgatgcggccatcgatggcttcgcccaaatccta
acggtcgcgcatgccggccgtcgctacagcatcaagctgccgctggtcggcgagttccag
atcgagaacgcgctggtcgcagccggtctggtaatcggcaccggcggcgattcggcggcg
agcttcgcggcgctcgaacatctcgaaggcgctcctgggcggctcgatctggtcggcgcc
catcgcggcgcgccggtgttcgtcgactatgcgcacaagcccgacgcgcttgccaagtcg
ctgcaggcgctgcggccctacgcaaagcgcaagctggtggtggtgttcggcgccggcggc
gaccgcgatgccggcaagcggccgctgatgggcgcgatcgccgccgagcatgccgacacg
gtgatcgtcaccgacgacaatccgcgcagcgaagatcccgccgcgatccgcgctgcgatc
ctcgctgccgcgcccggcgcgcgcgcgatcggcgaccgtgccgaggcgatccgcaccgcg
atcggcgaattgcagccgggcgacgcgctggtgatcgccggcaagggccacgaaaccggg
cagatcgtgggtgaccgcgtgctgccgttcagcgatcacgacgccgcgaaagcggcgcta
tcagcgagcgccgcatga

DBGET integrated database retrieval system