KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_1991Help
Entry
Rpdx1_1991        CDS       T01381                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
rpx  Rhodopseudomonas palustris DX-1
Pathway
rpx00790  Folate biosynthesis
rpx01100  Metabolic pathways
Module
rpx_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rpx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rpdx1_1991
Enzymes [BR:rpx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Rpdx1_1991
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF EIF_2_alpha
Motif
Other DBs
NCBI-ProteinID: ADU43600
JGI: Rpdx1_1991
UniProt: E6VNI1
Position
2121103..2121792
Genome map
AA seq 229 aa AA seqDB search
MDAKIKPIRGTKPADARSEFQPAELDPSDFLEVAVQPDQPRPSRAEAEAAVKTLLSYIGE
NTEREGLLDTPRRVVEAYDELFQGYHQCPKEVLERTFGETAGYDDFVLVRNISFTSHCEH
HVMPFYGKAHIAYTPVERVVGLSKLARLVDIFARRLQTQEHLTAQIAAAIDEVMKPRGVA
VLIEAEHTCMSVRGIAKKGATTFTSRYTGVFRDNPAEQARFMSMVRDRG
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggacgccaaaatcaagccgatccgcggcaccaagccggccgacgcccgcagcgaattc
cagcccgccgaactcgacccgtcggatttcctggaagtggcggtgcagcccgatcaaccg
cgcccgtcgcgcgccgaggccgaggccgcggtgaagacgctgctgtcctatatcggcgag
aacaccgagcgcgagggcctgctcgacaccccgcgccgggtggtcgaagcctatgacgaa
ctgttccagggctatcaccagtgcccgaaggaagtgctggaacgcaccttcggcgagacc
gccggctacgacgacttcgtgctggtccgcaacatcagcttcacctcgcattgcgagcac
cacgtgatgccgttctacggcaaggcgcacatcgcctatacgccggtcgagcgcgtggtc
gggctgtcgaagctggcgcggctggtcgacatcttcgcccggcggctgcagacccaggag
catctcaccgcgcagatcgccgccgcgatcgacgaggtgatgaagccgcgcggcgtcgcg
gtgctgatcgaggccgagcacacctgcatgtcggtgcgcggcatcgccaagaagggcgcc
accaccttcaccagccgctacaccggcgtgttccgcgacaatccggcggagcaggcgcgg
ttcatgtcgatggtcagggatcgcggctaa

DBGET integrated database retrieval system