KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_2063Help
Entry
Rpdx1_2063        CDS       T01381                                 

Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
rpx  Rhodopseudomonas palustris DX-1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rpx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rpdx1_2063
   00030 Pentose phosphate pathway
    Rpdx1_2063
   00051 Fructose and mannose metabolism
    Rpdx1_2063
   00052 Galactose metabolism
    Rpdx1_2063
   00500 Starch and sucrose metabolism
    Rpdx1_2063
   00520 Amino sugar and nucleotide sugar metabolism
    Rpdx1_2063
  Nucleotide metabolism
   00230 Purine metabolism
    Rpdx1_2063
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Rpdx1_2063
Enzymes [BR:rpx01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Rpdx1_2063
    5.4.2.8  phosphomannomutase
     Rpdx1_2063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2202330..2203826
Genome map
AA seq 498 aa AA seqDB search
MFPTPQPLLTANTYAYESEPMVKPTGFREYDARWLFGQEINLMGVQALGMGLGTLIAELG
RPQEIVTGHDFRSYSASIKYALIAGLMASGCKVHDIGLAVTPMAYYAQFDLDVPCVAMVT
ASHNDNGWTGVKMGANRPLTFGPDEMNRLKQIVLGAAFKTGSGSYVFHENYPARYIADLT
KHARLKRKLKVVVACGNGTAGAFAPQVMEAIGCEVIPLDTELDHTFPKYNPNPEDMEMLH
AIRDAVLQHNADLGLGFDGDGDRCGVVDDTGEEIFADKVGVMLARDMSAIHPNARFVVDV
KSTGLFATDPVLQRQGARTEYWKTGHSYMKRRTNESNALAGFEKSGHFFFNAPLGRGYDD
GLVSAIAICEMLDRAPDKSMSQLKGALPKTWSSPTMSPHCADEVKYRVIDEVVKHFEAAQ
ANGDLVAGQKIRDLVTVNGVRVTCADGSWGLVRASSNKPELVVVVESPVSEQRMHDMFEA
VNLVLRQHPEVGAYNQTI
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgtttccgacgccgcagccgcttctgacggccaacacctacgcctacgaatccgagccg
atggtcaagccgaccggcttccgggaatacgacgcgcgctggctgttcggccaggagatc
aacctgatgggcgttcaggcgctgggcatggggctcggcacgctgatcgccgagctcggc
cggccgcaggagatcgtcaccgggcacgacttccggagctattcggcgtcgatcaaatac
gcgctgattgccgggctgatggcgtcgggctgcaaggtgcacgacatcgggctggcggtg
acgccgatggcgtattacgcgcagttcgatctcgacgtgccgtgcgtcgcgatggtgacc
gcctcgcacaacgacaacggctggaccggcgtcaagatgggcgccaaccggccgctgacc
ttcggccccgacgagatgaaccggttgaagcagatcgtgctcggcgcggcgttcaagacc
ggcagcggctcctacgtctttcatgagaactatccggcgcgctacatcgccgacctgacc
aaacacgccaggctgaagcgcaagctgaaggtggtggtcgcctgcggcaacggcaccgcc
ggcgcgttcgccccgcaggtgatggaggcgatcggctgcgaggtgatcccgctcgacacc
gaactcgaccacaccttcccgaaatacaatccgaaccccgaagacatggagatgctgcac
gcgatccgcgacgcggtgctgcagcacaacgccgatctcggcctcggcttcgacggcgac
ggcgaccgctgcggcgtggtcgacgacaccggcgaggagatcttcgccgacaaggtcggc
gtgatgctggcgcgcgacatgtcggcgatccaccccaacgcgcgcttcgtggtcgacgtc
aaatccaccggcctgttcgccaccgatccggtgctgcaacggcagggcgccaggaccgaa
tattggaagaccggccactcctacatgaagcgccgcaccaacgagagcaacgcgctcgcc
ggcttcgaaaaatccggccacttcttcttcaacgcgccgctcggccgcggctatgacgac
ggcctcgtctcggcgatcgcgatctgcgagatgctggaccgcgcgccggacaaatcgatg
tcgcagctcaagggcgcactgccgaagacctggtcgtcgccgacgatgtcgccgcattgc
gccgacgaggtgaagtatcgggtgatcgacgaggtcgtgaagcatttcgaagccgcacag
gcgaacggcgatctcgtcgccgggcagaagatccgcgatctcgtcaccgtcaacggcgtc
cgggtcacctgcgccgatggaagctgggggctggtgcgggcatcctcgaacaagcccgag
ctggtggtggtagtcgaaagcccggtgtccgagcagcggatgcacgacatgttcgaagcc
gtgaacctcgtgctgcgccagcatcccgaagtcggtgcgtacaatcagacgatctga

  All links  
No link information was found.   
DBGET integrated database retrieval system