KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_2063Help
Entry
Rpdx1_2063        CDS       T01381                                 

Definition
(GenBank) Phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
rpx  Rhodopseudomonas palustris DX-1
Pathway
rpx00010  Glycolysis / Gluconeogenesis
rpx00030  Pentose phosphate pathway
rpx00051  Fructose and mannose metabolism
rpx00052  Galactose metabolism
rpx00230  Purine metabolism
rpx00500  Starch and sucrose metabolism
rpx00520  Amino sugar and nucleotide sugar metabolism
rpx00521  Streptomycin biosynthesis
rpx01100  Metabolic pathways
rpx01110  Biosynthesis of secondary metabolites
rpx01120  Microbial metabolism in diverse environments
rpx01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rpx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rpdx1_2063
   00030 Pentose phosphate pathway
    Rpdx1_2063
   00051 Fructose and mannose metabolism
    Rpdx1_2063
   00052 Galactose metabolism
    Rpdx1_2063
   00500 Starch and sucrose metabolism
    Rpdx1_2063
   00520 Amino sugar and nucleotide sugar metabolism
    Rpdx1_2063
  Nucleotide metabolism
   00230 Purine metabolism
    Rpdx1_2063
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Rpdx1_2063
Enzymes [BR:rpx01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Rpdx1_2063
    5.4.2.8  phosphomannomutase
     Rpdx1_2063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ADU43671
JGI: Rpdx1_2063
UniProt: E6VPC2
Position
2202330..2203826
Genome map
AA seq 498 aa AA seqDB search
MFPTPQPLLTANTYAYESEPMVKPTGFREYDARWLFGQEINLMGVQALGMGLGTLIAELG
RPQEIVTGHDFRSYSASIKYALIAGLMASGCKVHDIGLAVTPMAYYAQFDLDVPCVAMVT
ASHNDNGWTGVKMGANRPLTFGPDEMNRLKQIVLGAAFKTGSGSYVFHENYPARYIADLT
KHARLKRKLKVVVACGNGTAGAFAPQVMEAIGCEVIPLDTELDHTFPKYNPNPEDMEMLH
AIRDAVLQHNADLGLGFDGDGDRCGVVDDTGEEIFADKVGVMLARDMSAIHPNARFVVDV
KSTGLFATDPVLQRQGARTEYWKTGHSYMKRRTNESNALAGFEKSGHFFFNAPLGRGYDD
GLVSAIAICEMLDRAPDKSMSQLKGALPKTWSSPTMSPHCADEVKYRVIDEVVKHFEAAQ
ANGDLVAGQKIRDLVTVNGVRVTCADGSWGLVRASSNKPELVVVVESPVSEQRMHDMFEA
VNLVLRQHPEVGAYNQTI
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgtttccgacgccgcagccgcttctgacggccaacacctacgcctacgaatccgagccg
atggtcaagccgaccggcttccgggaatacgacgcgcgctggctgttcggccaggagatc
aacctgatgggcgttcaggcgctgggcatggggctcggcacgctgatcgccgagctcggc
cggccgcaggagatcgtcaccgggcacgacttccggagctattcggcgtcgatcaaatac
gcgctgattgccgggctgatggcgtcgggctgcaaggtgcacgacatcgggctggcggtg
acgccgatggcgtattacgcgcagttcgatctcgacgtgccgtgcgtcgcgatggtgacc
gcctcgcacaacgacaacggctggaccggcgtcaagatgggcgccaaccggccgctgacc
ttcggccccgacgagatgaaccggttgaagcagatcgtgctcggcgcggcgttcaagacc
ggcagcggctcctacgtctttcatgagaactatccggcgcgctacatcgccgacctgacc
aaacacgccaggctgaagcgcaagctgaaggtggtggtcgcctgcggcaacggcaccgcc
ggcgcgttcgccccgcaggtgatggaggcgatcggctgcgaggtgatcccgctcgacacc
gaactcgaccacaccttcccgaaatacaatccgaaccccgaagacatggagatgctgcac
gcgatccgcgacgcggtgctgcagcacaacgccgatctcggcctcggcttcgacggcgac
ggcgaccgctgcggcgtggtcgacgacaccggcgaggagatcttcgccgacaaggtcggc
gtgatgctggcgcgcgacatgtcggcgatccaccccaacgcgcgcttcgtggtcgacgtc
aaatccaccggcctgttcgccaccgatccggtgctgcaacggcagggcgccaggaccgaa
tattggaagaccggccactcctacatgaagcgccgcaccaacgagagcaacgcgctcgcc
ggcttcgaaaaatccggccacttcttcttcaacgcgccgctcggccgcggctatgacgac
ggcctcgtctcggcgatcgcgatctgcgagatgctggaccgcgcgccggacaaatcgatg
tcgcagctcaagggcgcactgccgaagacctggtcgtcgccgacgatgtcgccgcattgc
gccgacgaggtgaagtatcgggtgatcgacgaggtcgtgaagcatttcgaagccgcacag
gcgaacggcgatctcgtcgccgggcagaagatccgcgatctcgtcaccgtcaacggcgtc
cgggtcacctgcgccgatggaagctgggggctggtgcgggcatcctcgaacaagcccgag
ctggtggtggtagtcgaaagcccggtgtccgagcagcggatgcacgacatgttcgaagcc
gtgaacctcgtgctgcgccagcatcccgaagtcggtgcgtacaatcagacgatctga

DBGET integrated database retrieval system