KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_2358Help
Entry
Rpdx1_2358        CDS       T01381                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
rpx  Rhodopseudomonas palustris DX-1
Pathway
rpx00230  Purine metabolism
rpx01100  Metabolic pathways
Module
rpx_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:rpx00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Rpdx1_2358
Enzymes [BR:rpx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Rpdx1_2358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 cobW MMR_HSR1 TsaE AAA_18
Motif
Other DBs
NCBI-ProteinID: ADU43949
JGI: Rpdx1_2358
UniProt: E6VDL5
Position
2533735..2534397
Genome map
AA seq 220 aa AA seqDB search
MSDGAAVGHNGVERRGVMFVLSSPSGAGKTTLSRMLVKEAAGLQMSVSATTRPMRPGEVE
GRDYFFVDRPKFDAMVAAGEFLEWANVFDNCYGTPRAPVEAALASGRDVLFDIDWQGTQQ
LRSHAPNDVVSVFVLPPSVQALEHRLHTRAQDSHDVIQGRMKKAGDEMSHYDAYDYIVVN
DNVGIAFESVKAILRAEQLKRERQIGIDAFVRDMRQQLEG
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacggagcggcggtcggacacaatggtgtcgagcggcgcggcgtgatgttcgtg
ttgtcgtcgccgtcgggcgccggcaagacgacactgtcgcggatgctggtgaaggaagcg
gccggtctgcagatgtcggtatcggccaccacgcggccgatgcggccgggtgaagtcgaa
ggccgcgactacttcttcgtcgatcgtccgaaattcgacgcgatggtcgccgccggagag
tttctcgaatgggcgaacgtcttcgacaattgctacggcacgccgcgcgcgccggtcgag
gcggcgctggcctccgggcgtgacgtgttgttcgatatcgattggcagggcacgcagcaa
ttgcgcagccatgctcccaacgacgtggtcagcgtgttcgtgctgccgccctcggtgcag
gcgctggagcaccgcctgcacacccgcgcgcaggacagccacgacgtcatccagggccgg
atgaagaaggccggcgacgagatgagtcattacgacgcttacgactacatcgtcgtcaac
gacaatgtcggtatcgcattcgagtccgtgaaggcgatcctgcgggccgagcagctcaag
cgtgagcgccaaatcggcatcgacgctttcgttcgcgatatgcgtcagcagctcgaaggc
tga

DBGET integrated database retrieval system