KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_2409Help
Entry
Rpdx1_2409        CDS       T01381                                 

Definition
(GenBank) asparagine synthase family amidotransferase
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
rpx  Rhodopseudomonas palustris DX-1
Pathway
rpx00250  Alanine, aspartate and glutamate metabolism
rpx01100  Metabolic pathways
rpx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpx00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Rpdx1_2409
Enzymes [BR:rpx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Rpdx1_2409
Peptidases [BR:rpx01002]
 Cysteine Peptidases
  Family C44
   Rpdx1_2409
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 K_oxygenase tRNA_Me_trans Arginosuc_synth
Motif
Other DBs
NCBI-ProteinID: ADU44000
JGI: Rpdx1_2409
UniProt: E6VEG8
Position
complement(2591054..2592793)
Genome map
AA seq 579 aa AA seqDB search
MRGEPSIAALKTIAGAMHKRGPDAEGLFAQGTMAFGHRRLSILDLAAASQQPMIDSELGL
GIVFNGCIYNFRELKDELTRRGYRFFSQGDTEVILKSYHAWGADCVSRFKGMFAFALWER
DSGRVVLARDRLGIKPLYYVDGPDSFRFASDLPALLAGGGVDTSLDPVGLHHFFSFHAAV
PPPRTILRGVKKLEPATLLTLEPDGSRTTRRYWSFTVGSAVDRVMTEQEWSEAVTDAMLT
AVDRRRVADVPVGVLLSGGLDSSLIVALLAKLGHSDVKTFAIGFDSVGGQSGDEFYYSDL
VAKHFSSTHEQIRIDGREALQHLPDAIRAMSEPMVSHDAVAFYLLSREVAKRVTVVQSGQ
GADEVFGGYSWYPSLLTANNAADQYREVYFDWKHTDIARLLTPDLLSADHSSDFVERFFD
LTSASSPVDKALQIDAEIMMVDDPVKRVDNMTMAHGLEARVPFLDHDVVELAARIPASLK
LGDGGKYILKQAARALLPTEVIDRPKGYFPVPSLRHLRGDFLDYVRDILTSPAARSRGLY
RSAFIEHMLHHPEAEKSPKGHSRLWQAALLEGWLQAHAI
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggcgaaccctcgatcgccgctttgaagacgatcgccggcgcgatgcacaagcgc
gggcccgatgcggaaggactgttcgcgcaaggcaccatggcgttcggccatcggcgactc
agcattctcgatctggcagcagcctctcagcagccgatgatcgacagcgagctgggactc
ggcatcgtcttcaacggctgcatctacaatttccgcgaactcaaggacgaactgacgcgg
cgcggctatcggttcttctcgcaaggcgacaccgaagtcatcctcaagagctatcatgcc
tggggggcggactgcgtatcacgtttcaagggcatgttcgccttcgcgttgtgggagcgc
gacagcggccgcgtcgtgctggcccgcgaccgtctcggcatcaaaccgctctactacgtc
gatggccctgactctttccgcttcgcctccgatctgcccgccttgctggcgggcggtggt
gtcgatacctcgctcgatcctgtcgggctgcatcacttcttcagcttccacgccgctgtg
ccaccgccgcgcaccattctgcgcggcgtgaagaagctggagcccgccaccctcctcacc
ctggagccggatggttccagaaccacgcggcgctattggagtttcacagtcggctcggcc
gtcgatcgggtgatgaccgagcaagagtggagcgaggccgttaccgatgcgatgctgacg
gcggtcgatcgccgccgcgtcgccgacgtccctgtcggcgtgctgctgtcgggcggattg
gattcatcgctgatcgtcgcgctgctcgccaaactcggccattccgacgtcaagaccttc
gcgatcggcttcgacagcgtcggcgggcaaagcggcgacgagttctactattccgatctg
gtggcgaagcacttctcgtcaacgcacgagcagatcagaatcgacggccgcgaggcattg
cagcatctgccggacgcgatccgggcgatgtccgagccgatggtcagtcacgatgcggtt
gcgttctatctgctgtcgcgcgaggtcgccaagcgggtgacagtagtgcagagcggccag
ggtgccgacgaagtgttcggcggctatagctggtacccctcactgctcaccgccaacaat
gccgccgatcagtatcgcgaggtgtattttgattggaagcacaccgacatcgccaggttg
ttgacgcccgatctgctctcggcggatcacagttcggacttcgtcgagcgctttttcgac
ctgacctcggcgagttccccggtcgacaaggcgctgcagatcgacgccgagatcatgatg
gtcgacgatccggtcaagcgggtcgacaacatgaccatggcgcatggtctcgaagcccgg
gtgccgtttctcgaccacgacgtggtcgagctcgccgcccggatcccggcctcgctcaag
ctcggcgatggtggcaagtacatcctcaaacaagccgcccgcgcgttgcttccgaccgaa
gtgatcgaccgccccaagggatatttcccggtgccgtcgctgcggcatctgcgcggcgat
ttcctcgactacgttcgcgacatcctgacctccccggccgcgcgcagccgcggtctgtat
cgctccgcgttcatcgaacacatgctccatcatcccgaagcagaaaagagcccgaagggc
cattcgcggctgtggcaggccgctctcctcgaagggtggctgcaggcccatgcgatttga

DBGET integrated database retrieval system