KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_2616Help
Entry
Rpdx1_2616        CDS       T01381                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rpx  Rhodopseudomonas palustris DX-1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:rpx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rpdx1_2616
   01230 Biosynthesis of amino acids
    Rpdx1_2616
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rpdx1_2616
   00051 Fructose and mannose metabolism
    Rpdx1_2616
   00562 Inositol phosphate metabolism
    Rpdx1_2616
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Rpdx1_2616
Enzymes [BR:rpx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Rpdx1_2616
Exosome [BR:rpx04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Rpdx1_2616
  Exosomal proteins of bladder cancer cells
   Rpdx1_2616
  Exosomal proteins of melanoma cells
   Rpdx1_2616
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2801825..2802601
Genome map
AA seq 258 aa AA seqDB search
MPVPAVRPLIAGNWKMNGLMDSVAELDAMLKGAGELPQGIDLLVCPPATLVASFAARVAE
AHGGKALPFAIGGQDCHANVSGAHTGDIAAEMLADAGAAAIIVGHSERRADHAETDAIVR
AKAQAVWRAGLVAIVCVGETQGERDAGHTLDVVAGMLAGSLPDGATAANLVVAYEPVWAI
GTGRTPTTADVEQVHGFIRQTLSERFGAAGETMRILYGGSVKPSNARELLAVPHVNGALI
GGASLKASDFLAIAAGCP
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgccggtccccgccgttcgtccgctgattgctggaaactggaagatgaacggcctgatg
gattccgtcgccgagcttgatgcgatgctgaagggcgccggtgagctgccccagggcatc
gatcttttggtctgtccgccggcgacgctggtggcgagcttcgcggcgcgagtcgcggaa
gcgcacggcggcaaggcgctgccgttcgcgatcggcggtcaggactgccatgccaacgtg
tccggcgcgcataccggcgacatcgccgccgagatgctggccgatgccggcgccgcggcg
atcatcgtcggtcattcggagcgccgcgccgaccatgccgagaccgacgcgatcgttcgt
gccaaggcgcaggcggtgtggcgtgcggggctggtggcgatcgtttgcgtcggcgagact
cagggcgagcgtgacgccggccacaccctcgatgtggtggccgggatgctggccgggtcg
ctgccggacggcgccaccgcggcgaatctggtggtggcctacgagccggtctgggcgatc
ggcaccggccgcaccccgacgacggccgatgtcgagcaggttcatggctttatccgccag
accctgagcgaacggttcggcgccgccggggagacgatgcggattctgtacggcggctcg
gtgaagccctcgaatgcccgcgaattgctggcggtgccgcacgtcaacggcgccctgatc
ggcggcgcgagcctgaaggcgtcggatttccttgcgattgctgccggctgtccctaa

DBGET integrated database retrieval system