KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_2652Help
Entry
Rpdx1_2652        CDS       T01381                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
rpx  Rhodopseudomonas palustris DX-1
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpx00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Rpdx1_2652
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Rpdx1_2652
Enzymes [BR:rpx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Rpdx1_2652
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2838965..2839990
Genome map
AA seq 341 aa AA seqDB search
MPPRAFITGIAGLNLSDDERGFLRDSRPWGFILFKRNVDNPAQVKALVDDLRGTIGSPDA
PVLIDQEGGRVQRLAPPHWPAYPPGAVFSTLYDIDPDAGLTAARLSARLIADDLAALGIT
VDCLPLADVPVAGADAVIGDRAYGTTPNKVATIARAVSDGLAQGGVLPVLKHIPGHGRAT
ADSHYRLPTVDTSREELDRTDFAAFRPLADLPMAMTAHVVFSALDPAQPATTSATIIDRV
IRESIGFQGLLMSDDVSMNALAGSIAERTRAIVAAGCDVVLHCNGKLDEMRQVVAETPEL
AGRALARAEAALAARRPPQPFDRAAARAELDTLIGRSRVSV
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgccaccgcgcgctttcattaccggcattgccggcctcaatctcagcgacgacgagcgc
ggatttctccgcgattcccgtccgtggggcttcattcttttcaagcgcaatgtcgacaat
ccggcgcaagtcaaggcgctggttgacgatttgcgcggaaccatcggttcccccgacgcg
ccggtcctgatcgatcaggaaggcgggcgggttcagcggctcgcaccgccgcattggccg
gcctatcccccgggcgcggtgttctccacgctttatgacatcgacccggacgccgggttg
accgcggcgcgtctgagcgcccggctgatcgccgacgatcttgcagcgctcggcatcacc
gtcgactgcctgccgcttgccgacgtgccggtcgccggcgccgatgcggtgatcggcgat
cgtgcctatggcaccacgcccaacaaggtcgcaacgatcgcccgcgcggtcagcgacggc
ctggcgcagggcggcgtgctgccggtgctgaagcacatccccggccacggccgcgccacc
gccgacagtcattatcggctgccgaccgtcgacacctcgcgcgaagagctggatcgcacc
gatttcgccgcgttccggccgctcgccgacctgccgatggcgatgactgcacatgttgtg
tttagcgcgctcgatcccgcccaaccggcgaccacttctgcgacaatcatcgatcgggtg
attcgtgagtcgatcgggttccaaggattgctgatgagcgacgacgtttcgatgaacgcg
ctggccggcagcatcgccgagcgcacccgcgcgatcgtcgcggcgggctgcgacgtcgtc
ctacattgcaacggcaagctcgacgaaatgcgccaggtcgttgccgaaacaccggaactg
gcgggcagggcgctggcccgtgccgaggcggcgctggcggcgcgccgccccccgcagccg
ttcgaccgggccgcggcgcgggccgagctcgacaccttgatcggccgctcgagggtgagc
gtatga

DBGET integrated database retrieval system