KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_2792Help
Entry
Rpdx1_2792        CDS       T01381                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
rpx  Rhodopseudomonas palustris DX-1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:rpx00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2979414..2980466
Genome map
AA seq 350 aa AA seqDB search
MAIKFGRPIEIRDPSTRPAAPPLDLTIRPRRNRKTEWARRLVRENVLTTDDLIWPMFVID
GSNQRVQVASMPGVERLSVDQIVRDAERAAKLDIPCIALFPFTEPSLRDEHGTEASNPEN
LICKTVRAIKKEFPQIGVLCDVALDPYTSHGHDGLIEDGRILNDETVAVLVQQSLVQAEA
GCDVIAPSDMMDGRIGAIREALDAAGYLDVQIMAYAAKYASAFYGPFRDAIGSAKALTGD
KRTYQMDPANTDEAIREVELDLAEGADMVMVKPGMPYLDIVRRVKETFGVPTFAYQVSGE
YAMIAAAANNGWLDGDRAMMESLLAFKRAGANGVLTYFAPAAAEKLRQLG
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcaaattcggccgtcccatcgagattcgcgacccctcgacccggcccgccgct
ccgccgctcgatctcaccatccgtccgcgccgcaaccgcaagaccgagtgggcccgccgc
ctggtgcgtgagaacgtcctgaccaccgacgacctgatctggccgatgttcgtgatcgac
ggaagcaaccagcgggttcaggtcgcctcgatgccgggggtcgaacggctcagcgtcgat
cagatcgtccgcgacgccgaacgcgctgccaagctcgatatcccgtgcatcgcgctgttc
ccgttcaccgagccgtcgctgcgcgacgagcacggcaccgaagcgtccaatccggaaaac
ctgatctgcaagaccgtccgcgcgatcaagaaggaatttcctcagatcggcgtgctgtgc
gacgtcgcgctcgatccctacaccagccacggtcatgacggcctgatcgaggacggccgc
atcctcaacgacgagaccgtcgcggtgctggtgcagcaatcgctggtgcaggccgaggcc
ggctgcgacgtgatcgcgccatcggacatgatggacggccgcatcggcgcgatccgcgag
gcgctcgatgccgccggctatctcgacgtccagatcatggcttatgcggccaagtatgcg
tccgccttctacggcccgttccgcgacgcgatcgggtcggccaaggcgctgaccggcgac
aagcgcacctatcagatggacccggccaacaccgacgaagcgatccgcgaggtcgaactc
gatctcgccgaaggcgccgacatggtgatggtcaagccgggcatgccgtatctcgacatc
gtccgccgcgtgaaggaaaccttcggcgtgccgaccttcgcctatcaggtgtcgggcgag
tacgcgatgatcgccgcggccgccaacaacggctggctggacggcgaccgggcgatgatg
gagagcctgctcgccttcaagcgcgccggcgccaacggcgtgctgacctacttcgccccg
gcggccgccgagaagttgaggcagttgggctga

DBGET integrated database retrieval system