KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_3037Help
Entry
Rpdx1_3037        CDS       T01381                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
rpx  Rhodopseudomonas palustris DX-1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3228460..3229527
Genome map
AA seq 355 aa AA seqDB search
MAALQDDHDRTMAYAEVALSQIKNLRHGAGPRNYEIWYTYATGHNQELNRAINDTLAHRG
SLSEADLDQLHDTYLSQGRATDRIDRIGARVAGEIDDIMAMLAETLGSTASFGDDLHGKS
QKLSLATDHDQIKAIVERLVVTTREMRQTNSALEQRLSASKQEIANLQLSLEAIRNESLT
DPLTGLGNRKHFDRTVHDALRSAAASHQPLSLLMMDIDHFKSFNDTYGHLTGDQVLRLVG
LTLKQSIKGQDFTARYGGEEFAVVLPNTPLRQAIIVADNIRRQVMSKELKKKSTGEILGR
VTLSAGVSTLKPNDDVESLIGRADACLYAAKRNGRNRVVCETDPEHSNDTRAAVA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtggccgcgctgcaggacgaccatgatcgcaccatggcctatgccgaggtggctctttcc
caaatcaagaacctccgccacggcgccggacctcgcaactacgagatctggtacacctat
gcgaccggccacaaccaagagctgaatcgcgcaatcaacgacacgctggcgcatcgcggc
agcctgagcgaggcggacctcgaccagctccacgatacctatctgtcgcaaggccgcgcc
accgatcggatcgaccggatcggcgcacgcgtcgcgggagagatcgacgacatcatggcg
atgctcgccgaaaccctcggcagcaccgccagcttcggtgacgatctccacggcaaaagc
cagaaactgtcgctggcgaccgaccacgaccagatcaaggcgatcgtcgagcgcctcgtc
gtcaccacgcgcgagatgcggcagaccaacagcgcgctggaacagcggctgtcggcatcg
aagcaggagatcgccaacctccagctcagcctggaagcgatccgcaacgagagcctcacc
gaccctttgaccgggctcggcaatcgcaaacatttcgatcgtaccgtccacgacgcgctg
cgcagcgccgctgcgagccatcagccgctgtcgctgctgatgatggacatcgaccacttc
aaatcattcaacgacacttacggccacctcaccggcgatcaggtgctgcgcctggtcggg
ctcactttgaagcagagcatcaagggccaggacttcaccgctcgctacggcggcgaggaa
ttcgccgtggtgctgccgaacacgccgctgcgccaggcgatcatcgtcgccgacaacatc
cgccggcaggtgatgtccaaggagctgaagaaaaaatcgacaggcgaaatcctgggccgc
gtgacgctgtccgccggggtgtcgacgctgaagccgaacgacgacgtcgaatccctgatc
ggccgcgccgacgcctgcctgtacgcggccaagcgcaacggtcgcaatcgcgtcgtgtgc
gaaaccgacccggaacattcgaacgatacccgggctgcggtggcctga

DBGET integrated database retrieval system