KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_3685Help
Entry
Rpdx1_3685        CDS       T01381                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
rpx  Rhodopseudomonas palustris DX-1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rpx00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3942495..3943352
Genome map
AA seq 285 aa AA seqDB search
MTASPSVPASPAVPAETPQLRELLARPAAAVMGILNVTPDSFSDGGDYLAPEQARAHAAE
MIADGAEIIDIGAESTRPYGSQPVPAAEELRRLQPVLEAVVALGTPVSIDTMKAEVAAWA
LDHGAAIANDVWGLQRDSEMAGVIAARGAPVIVMHNRDAADPAIDIVADINAFFERSLTI
AAKAGIAEELIVLDPGIGFGKTPQQSMITLARLREFAAFGRPLLIGASRKRFISTVVPSE
PKQRIGGSLAAHLIAVENGARIIRAHDVAATSQALKVAHAIRDSR
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcttccccgtcggtgcccgcatcgcccgccgttccggccgagacgccgcagttg
cgcgagctgctggcgcgtcccgccgcggcggtgatgggcattctcaacgtcacgccggat
tcgttctcggacggcggcgattatctcgcacccgagcaggcgcgggcccatgcggccgag
atgatcgcggatggcgccgagatcatcgacatcggcgcggaatccacccgtccctatggc
tcgcagccggtgcccgccgccgaggagctgcggcggctccagccggtgctggaggcggtg
gtggcgctcggcacgccggtgtcgatcgacaccatgaaggccgaggtcgccgcgtgggcg
ctcgaccacggtgcggcgatcgccaacgacgtctgggggttgcagcgcgattccgagatg
gccggcgtgatcgctgcgcgcggcgcgccggtgatcgtgatgcacaaccgcgacgccgcc
gacccggcaatcgacatcgtcgccgacatcaatgcattctttgaacgctcgctgacgatc
gctgcgaaggccggcatcgccgaggaactgatcgtgctcgatcccggcatcggcttcggc
aaaacgccgcagcagagcatgatcacgctggctcggctgcgcgaattcgcggcgttcggc
cggccgctgctgatcggcgcctcgcgcaagcgcttcattagtacggtggtgccgagcgaa
ccgaagcagcggatcggcggctcgctcgccgcacatctgatcgccgtcgagaacggcgcc
aggatcattcgcgcgcacgacgtcgccgcgacctcgcaggcgctcaaagtcgcccacgcc
atcagggatagccgatga

DBGET integrated database retrieval system