KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_3687Help
Entry
Rpdx1_3687        CDS       T01381                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
rpx  Rhodopseudomonas palustris DX-1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rpx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rpdx1_3687
Enzymes [BR:rpx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Rpdx1_3687
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3943716..3944207
Genome map
AA seq 163 aa AA seqDB search
MPRALIALGGNVGDVRATFDKAIANICGMTQAELIARSPDYATPPWGDEQQDRFVNACIE
IECRLDPLSLLQVLHKIEKRFGRDRASERRWGPRTLDLDLLAYDDAVINRPDLTLPHPRL
FERAFVLVPLLDIVPDQMIAGRSLKDALAGLSTAGIERLPDRG
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcgccctgatcgcgctcggcggcaatgtcggcgacgttcgcgccacgttcgac
aaggcgatcgccaacatctgcggcatgacccaggccgagctgatcgcgcgctccccggac
tacgcgacgccgccttggggcgacgagcagcaggaccgcttcgtcaatgcctgcatcgag
atcgaatgccgtctggatccgctgtcgttgctgcaggtcctgcataagatcgagaaacgt
ttcggccgcgaccgcgccagcgaacggcgctggggcccgcgcacgctcgatctcgacctt
ctcgcctacgacgacgccgtgatcaatcgaccggacctgacgctgccgcatccgcgactg
ttcgagcgcgccttcgtgctggtgccgctgctcgacatcgtgccggatcagatgatcgcc
ggtcgctcgctgaaagacgccctcgccgggctgtcgaccgccggcatcgagcggctgcca
gatcgcggctga

DBGET integrated database retrieval system