KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_3896Help
Entry
Rpdx1_3896        CDS       T01381                                 

Definition
inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
rpx  Rhodopseudomonas palustris DX-1
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:rpx00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4182398..4183225
Genome map
AA seq 275 aa AA seqDB search
MTAAFEQPAVVSSEHAAALLAPLTEVVLRAGAAIVAISRDTPVLHKGDGSPVTAADLAAD
RVIAEGLAAVAPDLPVLSEESCSGGRPSSGSFFVVDPLDGTKEYIAGRDEFTVNLALVSD
GVPVLGIVGAPALGLAWRGVAGHGAERLTLAADGRSFAAEPIRTRPLPKPGEPWVATVSR
SHLDAATVAFIDARPGAVHATLGSSLKFCRIAEGEADIYPRLASICEWDIAAGAALVIAA
GGKVTDTSGAPLRFDEPRPNFIVPEFIAWGDRSGR
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgactgccgcgttcgaacagcccgccgtcgtttcctccgagcacgccgccgctttgctt
gcgccgctgaccgaggtggtgttgcgcgccggagccgcaatcgttgcgatttcacgagat
acgccggtgctgcacaaaggcgacggctcgccggtgacggccgccgatctcgccgcagac
cgggtgatcgccgaagggctggccgcggtcgcgccggatttgccggtgctgtcggaagaa
tcctgcagcggcgggcgtccgagctcgggcagcttcttcgtggtcgatccgctcgacggc
accaaggagtacatcgccggccgggacgaattcaccgtcaacctggcgctggtgagcgac
ggcgtgccggtgctcggcatcgtcggtgcgccggcgctcggattggcctggcgcggcgtc
gccggtcacggcgccgagcggctgacgctcgcggccgacggccgcagcttcgccgccgag
ccgatccggacgcggccgctgcccaaaccgggcgagccgtgggtcgccacggtcagccgc
tcgcatctcgatgccgccaccgtcgccttcatcgacgcccgccccggtgcggtccacgcg
acgctgggatcgtcgctgaaattctgccgtatcgccgaaggcgaggccgacatctacccg
cggctggcatcgatctgtgaatgggacattgcggccggcgccgcgctggtcatcgcggcc
ggcggcaaggtcaccgacaccagcggcgcaccgctgcggttcgacgaaccacggccgaac
ttcatcgtgccggagttcatcgcctggggcgatcgcagcggacgctag

DBGET integrated database retrieval system