KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_3984Help
Entry
Rpdx1_3984        CDS       T01381                                 

Definition
cytochrome c class I
Orthology
K08738  
cytochrome c
Organism
rpx  Rhodopseudomonas palustris DX-1
Pathway
Sulfur metabolism
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:rpx00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:rpx02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Structure
PDB: 

Jmol
Position
4276439..4276858
Genome map
AA seq 139 aa AA seqDB search
MVKKLLTIVSIAATAGSLSIGTASAQDAKAGEAVFKQCMTCHRADKNMVGPALAGVVGRK
AGTVAGFTYSPLNHNSGEAGLVWTADNIVPYLADPNAFLKKFLTEKGKADQAVGVTKMTF
KLANEQQRKDVVAYLATLK
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
gtggtcaaaaaacttctcactattgtcagcatcgccgctaccgcaggatccctgtcgatc
gggactgcctcggcgcaggatgccaaggcgggcgaggcggtgttcaagcagtgcatgacc
tgccaccgcgccgacaagaacatggtcggtccggcgctggccggcgtggtcggccgcaag
gcgggcactgtcgcgggcttcacctattcgccgctgaaccacaattcgggcgaagcgggt
ctggtctggaccgccgacaacatcgtcccgtatctggccgatccgaacgccttcctgaag
aagttcttgaccgaaaagggcaaggctgatcaggcggtcggcgtcaccaagatgaccttc
aagctcgccaacgagcaacagcgcaaggacgtggtggcctatctcgccacgctcaagtaa

DBGET integrated database retrieval system