KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_4015Help
Entry
Rpdx1_4015        CDS       T01381                                 

Definition
(GenBank) magnesium chelatase ATPase subunit I
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
rpx  Rhodopseudomonas palustris DX-1
Pathway
rpx00860  Porphyrin and chlorophyll metabolism
rpx01100  Metabolic pathways
rpx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rpdx1_4015
Enzymes [BR:rpx01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Rpdx1_4015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 AAA_22 MCM AAA_29 AAA DUF815 AAA_16
Motif
Other DBs
NCBI-ProteinID: ADU45571
JGI: Rpdx1_4015
UniProt: E6VJM1
Position
complement(4306313..4307335)
Genome map
AA seq 340 aa AA seqDB search
MATVFPFSAIVGQDEMKLALLIAAVDQKVGGVLAFGDRGAGKSTAVRALAALLPKMKTVV
GCRYNCDPDQPERYCEECKEKVKHGKVKTAQVPVPVVDLPLGATEDRVVGALDLERALAK
GEKAFEPGLLARAHRGFLYIDEANLLEDHLVDLLLDVAASGENVVEREGLSIRHPARFVL
VGTGNPEEGELRPQLLDRFGMSVEVKTPDTLPERIEVVRRRDAFENDPAAFVADWSKEEA
KLRRKISQAKERLPDVTVSDAALERAAKLCMTLGTDGLRGELTLMRAARALAALEHDKTV
TDDHLKRIAPSALRHRLRRNPLDDAGSSVRVDRALAEIFG
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggccacagtgtttccgttctccgcgatcgtcggccaggacgagatgaagctggcgctg
ctgatcgcggcggtggatcagaaggtcggcggcgtgctggcgttcggcgatcgcggtgcc
ggcaagtcgaccgcggtgcgcgcgctcgctgcgctgctgccgaagatgaagacggtcgtc
ggctgccgctataattgcgatcccgaccagcccgagcgctactgcgaagagtgcaaggag
aaggtcaagcacggcaaggtcaagaccgcgcaggtgccggtgccggtggtcgatctgccg
ctcggcgccaccgaagaccgcgtcgtcggcgcgctcgatctggagcgtgcgctggccaag
ggcgagaaagcgttcgagccgggcctgctggcacgggctcatcgcggcttcctctacatc
gacgaagccaacctgctcgaggaccatctggtcgacttgttgctcgacgtcgccgcatct
ggcgagaacgtggtcgagcgcgaagggctcagcatccgtcacccggcgcggtttgtgctg
gtcggcaccggcaacccggaagaaggcgagctgcgtccgcaattgctcgaccgcttcggc
atgtcggtggaagtgaagacgccggacacgctgccggaacgcatcgaagtggtgcgacgc
cgcgatgcgttcgagaacgatccggcggccttcgtggccgattggtcgaaggaagaggcc
aagctccgccgcaagatctcgcaggccaaggaacggctgcccgatgtcaccgtgagcgat
gcggcgctggagcgcgccgccaagctgtgcatgacgctcggaaccgacggcctgcgcggc
gaactcaccttgatgcgtgccgcgcgtgcgctcgctgcgctcgagcacgacaagaccgtg
accgatgatcacctgaagcggatcgcgccctctgcattgcggcaccggttgcgccgcaat
ccgctcgacgatgccggctccagcgtgcgggtcgaccgcgcgctcgccgaaatcttcgga
tga

DBGET integrated database retrieval system