KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_4073Help
Entry
Rpdx1_4073        CDS       T01381                                 

Definition
(GenBank) binding-protein-dependent transport systems inner membrane component
  KO
K02033  
peptide/nickel transport system permease protein
Organism
rpx  Rhodopseudomonas palustris DX-1
Module
Peptides/nickel transport system
Brite
Transporters [BR:rpx02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    Rpdx1_4073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(4372350..4373306)
Genome map
AA seq 318 aa AA seqDB search
MLNAPRLRIIGRRLLHAVPVVVLSTFIVFGLLKLVPGDVAVTLAGDNASEQRIAEIRELY
GLNQPFLVQYGSWLSKAVQGDLSTSLVSSEAVLTSIERCLPHTLLIVALALLTALAIGVP
LGIAAAAKPGSWIDGIVMAVASLGVAVPNFWLGMLLVAFFSLQLNWLPATGAVSLMKDPA
AALSHALLPALALASGGIAEVARQLRSSLVEILSSQQVRTLHAKGLPPSSILWRHGLKNV
SVNLLTVISLLANRMLAATVVVEAVFAIPGMGGLIVNAAMNRDFPVVQGVVFTMVLIVVA
LNLLTDILYSVLDPRIST
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgttgaacgctccgcgtctgcgcatcatcggtcgccgcctgctgcacgcggtgccggtg
gtggtgctctccaccttcatcgtattcggtctgctcaagctggtgccgggcgacgtcgcg
gtgacgttggcgggcgacaacgcgtccgagcagcgcatcgccgagatccgcgagctgtac
ggattgaaccagccgttcctggtgcaatacggctcgtggctgtcgaaggcggtgcagggc
gatctgtcgacttcgctggtgtcgagcgaggcggtgctgacctcgatcgagcgctgcctg
ccgcatacgctgctgatcgtggcgctggccttgctcacagctctggcgatcggtgtgccg
ctcggcatcgcggctgcggcaaagcctggctcgtggatcgacggcatcgtgatggcggtc
gcatcgctcggcgtcgcagtgccgaacttctggctcggcatgctgctggtggcgttcttc
tcgctgcagctcaattggctgccggcgaccggcgcggtgtcgctgatgaaggacccggcc
gccgcgctcagccacgcgcttctgccggcattggcgctcgcctccggcggcatcgccgag
gtggcgcggcaactgcgctcgtcgctggtcgagatcctgtcgtcgcagcaggtccgcacg
ctgcacgccaaggggctgccgccgtcgtcgatcctgtggcggcacgggctgaagaacgtc
agcgtcaatctgctcaccgtgatcagcctgctcgccaaccggatgctggccgcgaccgtg
gtggtggaggcggtgttcgccattccggggatgggcggcttgatcgtcaacgcagcgatg
aaccgcgatttcccggtggtgcagggggtggtgttcaccatggtgctgatcgtggtggcg
ctcaatctgctcaccgacattctctacagcgtgctcgacccgaggatctcgacatga

DBGET integrated database retrieval system