KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_4136Help
Entry
Rpdx1_4136        CDS       T01381                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rpx  Rhodopseudomonas palustris DX-1
Pathway
rpx00071  Fatty acid degradation
rpx00280  Valine, leucine and isoleucine degradation
rpx00281  Geraniol degradation
rpx00310  Lysine degradation
rpx00360  Phenylalanine metabolism
rpx00362  Benzoate degradation
rpx00380  Tryptophan metabolism
rpx00410  beta-Alanine metabolism
rpx00627  Aminobenzoate degradation
rpx00640  Propanoate metabolism
rpx00650  Butanoate metabolism
rpx00903  Limonene and pinene degradation
rpx00930  Caprolactam degradation
rpx01100  Metabolic pathways
rpx01110  Biosynthesis of secondary metabolites
rpx01120  Microbial metabolism in diverse environments
rpx01130  Biosynthesis of antibiotics
rpx01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rpx00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Rpdx1_4136
   00650 Butanoate metabolism
    Rpdx1_4136
  Lipid metabolism
   00071 Fatty acid degradation
    Rpdx1_4136
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rpdx1_4136
   00310 Lysine degradation
    Rpdx1_4136
   00360 Phenylalanine metabolism
    Rpdx1_4136
   00380 Tryptophan metabolism
    Rpdx1_4136
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Rpdx1_4136
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Rpdx1_4136
   00281 Geraniol degradation
    Rpdx1_4136
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rpdx1_4136
   00627 Aminobenzoate degradation
    Rpdx1_4136
   00930 Caprolactam degradation
    Rpdx1_4136
Enzymes [BR:rpx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Rpdx1_4136
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ADU45691
JGI: Rpdx1_4136
UniProt: E6VL87
Position
4439691..4440467
Genome map
AA seq 258 aa AA seqDB search
MSSNPILTETQGRVGIITLNRPEVLNALNDALMDALGAALLAFDADDSIGAIVITGNARA
FAAGADITAMAEASYSDVYGSNFITRNWETIRRVRKPVLAAVAGLAYGGGCELALACDIV
IAGRSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLNAEEADRYGLVSRV
VDDDKLRDETVALASTIAAFSAPALMALKESLNRTFESTLAEGILFERRELHARFASADA
HEGIQAFLEKRAPRFTHR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
ttgtcgtccaatcccatcctcaccgaaacccagggccgggtcggcatcatcacgctgaac
cggcccgaagtcctcaacgcgctgaacgacgccctgatggatgcgctcggcgccgcgctg
ctggcgttcgacgccgacgacagcatcggcgccatcgtgatcaccggcaatgcccgcgcc
ttcgcggctggtgccgatatcacggcgatggcggaagccagctatagcgatgtctacggc
tcgaacttcatcacccgcaattgggagaccatccgccgagtgcgcaagccggtgctggcc
gcggtggcggggcttgcctatggcggcggctgcgaactggcgctcgcctgcgacatcgtg
atcgccggccgcagtgccaaattcgcgctgccggaaatcaagctcggcctgctgcccgga
gcgggcggcacgcaacgcctgccgcgcgcgatcggcaaggcaaaagccatggacatgtgc
ctgtcggcgcgaccgctcaacgccgaagaggccgatcgctacggcctggtatcgcgcgtc
gtcgatgacgacaagctgcgcgacgagaccgtggcgctggccagcacgatcgcggcgttc
tccgccccggcgctgatggcgctgaaggaaagcctcaaccgcaccttcgagagcacgctc
gccgaaggcatcctgttcgagcgccgcgagctgcacgcccgcttcgccagcgccgacgcc
cacgagggcattcaggctttcctggaaaagcgggcgccgcgcttcacccaccgatag

DBGET integrated database retrieval system