KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_4351Help
Entry
Rpdx1_4351        CDS       T01381                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
rpx  Rhodopseudomonas palustris DX-1
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpx00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Rpdx1_4351
Enzymes [BR:rpx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Rpdx1_4351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4685698..4687242
Genome map
AA seq 514 aa AA seqDB search
MNAPDLTRPPLTIRRISLDTGRENVAVISRRSHALRPDVFRGFSRVELRIGDKVLLATLM
ITDDDALIGPDELGLSEPAFRRFNEPVGTAVSVTPARSPASLDAVRAKIQGHTLSATEIT
AIVDDLAHFRYSDMEIAAFLISAARFTSTDELLALVGAMASVGTKLVWDTPIVVDKHCIG
GIPGNRTTMVVVPIVAAHGLMIPKTSSRAITSPAGTADTMELLARVDLDVEQMKQVVHAC
GGCLVWGGHVNLSPADDILISVERPLSLDTPEQMVASIMSKKLAAGSTRLLIDFPVGPSA
KVANANEAMRLRKLFEFVGDHFGIGVEVVTTDGRQPIGRGIGPALEARDVMAVLGNEPDA
PADLREKSLRLAAHLLEYDPKLRGGAGYARAKELLDSGAALKKMQQIIDAQGPSPCRVDL
GAHAADVLASADGVVNGIDCLRINRLARTAGAPVAKGAGIDLFKKIGDRVEKGEPLYRVY
ASDSAEFDLALAAAQAESGFSINHHTPADVDLVS
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
ttgaatgctcccgatctcacccgcccgccgctgaccatccggcggatcagcctcgacacc
ggccgcgagaatgtcgcggtgatctcccgccgctcccatgcgttgcgtcccgacgtgttc
cgcggcttcagccgcgtcgagttgcggatcggcgacaaagtgctgctggcgacgctgatg
atcaccgacgacgatgcgctgatcggccccgacgaactcggcctgtccgagccggcgttc
cgccgcttcaacgagccggtcggcaccgcggtgtcggtgacgccggcgcgctcaccggcc
agcctggatgcggtccgcgccaagatccagggccacacgctgtcggccacggagatcacc
gcgatcgtcgatgacctggcgcacttccgctactccgacatggagatcgccgcgttcctg
atcagcgccgcacggttcacctcgaccgacgaattgctggcgctggtcggcgcgatggcc
tcggtcggcaccaagctggtatgggacaccccgatcgtcgtcgacaagcactgcatcggc
ggcattcccggcaaccgcaccaccatggtggtggtgccgatcgtcgctgcgcacgggctg
atgattcccaagacctcgtcgcgcgccattacctccccggccggcaccgccgacaccatg
gagctgctggcgcgggtcgatctcgacgtcgagcagatgaaacaagtggtgcacgcctgc
ggcggctgcctggtgtggggcggccacgtcaacctgtcgcccgccgacgacatcctgatc
tcggtcgaacgtccgctgagtctcgatacacccgagcagatggtcgcctcgatcatgtcg
aagaagctcgccgccggctcgacccggctgctgatcgacttcccggtcggcccgtcggcg
aaggtggcgaacgccaacgaggcgatgcggctgcgcaagctgttcgaattcgtcggcgat
catttcggcatcggcgtcgaggtggtcaccaccgacggtcgccagccgatcggccgcggc
atcgggccggcgctggaagcgcgcgacgtgatggcggttctgggcaacgagccggacgcg
cccgcggacttgcgtgagaagtcgctgcggctcgcggcgcatcttttggagtatgatccg
aagttgcgcggaggcgccggctatgcccgcgccaaagagctgctcgacagcggcgctgcg
ctgaagaagatgcagcagatcatcgacgcgcaggggccgtcgccctgccgtgtcgacctc
ggcgcgcacgccgccgacgtgcttgcttccgccgatggcgtggtcaacgggatcgactgc
ctgcgcatcaaccgcctcgcccgcaccgccggcgccccggtggccaagggcgccggaatc
gacctgttcaagaagatcggcgaccgcgtcgaaaaaggcgagccactgtaccgggtgtat
gcgtccgacagcgcggaattcgatctggcgctggccgcggcgcaggcggagtccggcttc
tcgatcaatcatcacaccccggcagacgtggacctggtgtcgtga

DBGET integrated database retrieval system