KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_4428Help
Entry
Rpdx1_4428        CDS       T01381                                 

Definition
(GenBank) Glutaminase, core
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
rpx  Rhodopseudomonas palustris DX-1
Pathway
rpx00220  Arginine biosynthesis
rpx00250  Alanine, aspartate and glutamate metabolism
rpx00471  D-Glutamine and D-glutamate metabolism
rpx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpx00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Rpdx1_4428
   00220 Arginine biosynthesis
    Rpdx1_4428
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Rpdx1_4428
Enzymes [BR:rpx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Rpdx1_4428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: ADU45979
JGI: Rpdx1_4428
UniProt: E6VPK0
Position
complement(4759284..4760219)
Genome map
AA seq 311 aa AA seqDB search
MSNNLLDRAVAEIADEMAQRADRGEVASYIPELARVDPKRFGLVVIDADGHVAAAGDADV
PFSIQSISKVFTLTLALGKAGDRLWRRVGREPSGSAFNSIVQLEHERGIPRNPFINAGAI
AVTDLILSGHQPREALGEILRFMQFLAGDTSIVIDDAVAKSEQRTGFRNAALANYMKSFG
VLDNPVEYTLGVYFHHCAIAMSCRQLAMAGRFLAYNGQNPSTGHNVVSSERARRINALML
TCGHYDGSGEFAYRVGLPGKSGVGGGILAVAPGKASIAVWAPGLDAAGNSHLGRVALEAL
TKRMGWSIFGV
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgagcaataaccttctcgaccgcgccgttgccgaaatcgccgacgagatggcgcagcgg
gcggaccgcggcgaggtggcgagctacatccccgagctggcgcgggtcgacccgaagcgc
ttcgggctggtggtgatcgacgccgatggtcacgttgccgccgccggtgatgccgacgtg
ccgttctcgattcagagcatctcgaaggtgttcacgctgacactggcgctcggcaaggcc
ggcgatcggctgtggcggcgcgtcggccgtgagccgtcgggctcggcgttcaattcgatc
gtgcagctcgaacacgagcgcggcattccgcgcaatccgttcatcaacgccggcgccatc
gcggtcaccgatctgatcctgtccggacaccagccgcgcgaggcgctcggcgaaattctg
cgcttcatgcagttcctcgccggggatacgtcgatcgtgatcgacgatgcggtcgcgaag
tccgagcagcgcaccgggtttcgcaatgccgcgctcgccaactacatgaagtcgttcggg
gtgctggacaatccggtcgaatacacgctcggggtctatttccatcactgcgcgatcgcg
atgagttgccggcaattggcgatggccgggcgttttctggcgtacaacggccagaacccc
tcgaccggccacaatgtggtgtcgagcgagcgcgcccggcgcatcaacgcgctgatgctg
acctgcggccattatgacggttcgggcgaattcgcctaccgggtcggcctgccgggcaag
agtggcgtcggcggcggcatcctcgcggtggcaccgggcaaagcctcgatcgcggtgtgg
gcgccggggcttgatgccgcggggaactcccatctcggccgcgtcgcgctggaggcgctg
accaagcgcatgggctggtcgatcttcggcgtctga

DBGET integrated database retrieval system