KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_4768Help
Entry
Rpdx1_4768        CDS       T01381                                 

Definition
glycoside hydrolase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
rpx  Rhodopseudomonas palustris DX-1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpx00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Rpdx1_4768
Enzymes [BR:rpx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Rpdx1_4768
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5126602..5127636)
Genome map
AA seq 344 aa AA seqDB search
MLRGGGIARLIATMLLASAVVAPVAGATRVSDDFAMASRMARGVNILGYDGIWEGGVDAP
FRLDHLDKIRQAGFDHVRINLFGFKFMDSADRLSDVYLERLDLVIHSAISAGLIPVIDAH
DTETCQIQIDVCRRKLAAFWRQVADRYAGQFPSLVFELLNEPGGHMTIAQWNSLLRELLA
TVRSSNPERIVVVAALNTPEASIESLELPATDRRIIVTFHYYEPFDFTHQGAPWSERLAG
LPAREWGSEQDRAKVAADFDRVQRFAAREARPVYLGEFGVYERAPRASRLRYLDDVARAA
ERRGWPWAYWQFDHDFALFDTERQIWHADVLRALIPPRRPLRRD
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgctgagaggcggcgggattgctcgactgatcgcgaccatgctgttggcctccgccgtc
gttgcgccggttgccggcgccacaagggtctcggacgattttgcaatggcgtcgcgcatg
gcgcggggcgtcaacattctcggctatgacggcatatgggagggcggcgtcgatgcgccg
ttccgattggatcatctcgacaagatcaggcaggccgggttcgaccacgtccgcatcaat
ctgttcgggttcaagttcatggacagcgccgatcgtttgagcgatgtctatctggagcgg
ctcgatctggtgatccacagcgcgatttcggccgggctcattccggtgatcgacgcgcac
gataccgagacctgccagatccagatcgacgtctgcaggcgcaagcttgcggcgttctgg
cgccaggtcgcggaccgctatgcggggcagtttccgagtctggtgttcgagctgctcaac
gagcccggcggacatatgacgatcgcgcagtggaacagtctgttgcgggaattgctcgcg
accgtgcgcagcagcaatcctgaacgcatcgtcgtcgttgctgcgctgaacacgccggag
gcatcgatcgaatctctcgaactccctgccacggatcgacggatcatcgtgaccttccac
tactacgaaccattcgacttcacccatcagggggcgccctggtcggagaggttggcagga
ctgccggcgagggagtggggcagcgaacaggacagggccaaggtcgccgcggatttcgat
cgcgtacaacggtttgccgcacgcgaagcgcgtccggtctatctgggggagttcggtgtc
tatgagcgggcgccgcgggccagccggttgcgctatctcgatgatgttgcgcgggccgcg
gagcggcgcggttggccgtgggcttattggcagttcgaccacgattttgcgctgttcgac
accgagcgccagatctggcatgcggacgtcctgcgcgcactgatacccccgcgccggccg
ctgcggcgcgactga

DBGET integrated database retrieval system