KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_4824Help
Entry
Rpdx1_4824        CDS       T01381                                 

Definition
acylglycerol lipase (EC:3.1.1.23)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
rpx  Rhodopseudomonas palustris DX-1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5182512..5183261
Genome map
AA seq 249 aa AA seqDB search
MSEAVMAGAEAFAFDGGKTGVLLVHGFTGSPQSMRYLGERLGERGYSILGPRLPGHGVSP
AAMAETTASDWVDCAEDALLELSARCDKTFVAGLSMGGTLSLYLAALHPDKVAGVIPINA
AVQIDSPDLAGLAYARGLPEFVPGIGSDMVDTTTKELAYDQVPVTCVKQVMGLAATARAL
LPKIKCPTLVINSRVDHVLSPTNATVIASHVGSSRIELRWLDNSYHVATIDNDKDLIAAE
IDGFVQRNL
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagcagtgatggccggcgcggaggcgttcgcgttcgacggcggcaagaccggc
gtgttgctggtgcacggatttaccggcagcccgcagagcatgcgctatctcggcgaacgg
ctcggggagcgcggctattcgattctcggcccgcggctgcccggacacggtgtctccccg
gccgcgatggccgagaccaccgcgagcgactgggtcgattgcgccgaggacgcactgctc
gagctgtccgccagatgcgacaagaccttcgtggccgggctgtcgatgggcggcacgctg
tcgctgtatctggcggcgctgcatccggacaaagtcgccggcgtgatcccgatcaacgcc
gctgtgcagatcgactcgcccgacctcgccgggctggcttacgcccgcggcctgccggaa
ttcgtccccgggatcggctcggacatggtcgacaccaccaccaaggagctggcctacgac
caggtaccggtgacctgcgtcaagcaggtgatgggtctggccgccaccgcccgcgcgctg
ctgcccaagatcaagtgcccgaccctggtgatcaattcgcgcgtcgaccacgtgctgtcg
ccgaccaacgccaccgtcatcgcgagccatgtcggctccagccggatcgaactgcggtgg
ctggacaactcctaccacgtcgccacgatcgacaacgacaaggatctgatcgccgccgag
atcgacggcttcgtgcagcggaatctgtga

DBGET integrated database retrieval system