KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_4905Help
Entry
Rpdx1_4905        CDS       T01381                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
rpx  Rhodopseudomonas palustris DX-1
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:rpx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rpdx1_4905
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Rpdx1_4905
Enzymes [BR:rpx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Rpdx1_4905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5277880..5278869
Genome map
AA seq 329 aa AA seqDB search
MAMSQTEVAHSDPARHVALLGVPIEIGAGLRGTLMGPAALRTAGIGRVLDQLGFAVEDHG
DMTRPAAGDGNDPVPANANYYSEVKSWVGAISARAYELARSGAVPLFMGGDHSLSMGSVN
GVARYWQEQSKPLFVLWFDAHADYNTPATTLTANMHGMSAAFLCGEPGLDHLLGDEPRVS
IPPSRLDLFGIRSIDPLEKELVRQRAIPVVDMRAIDEFGVGVLIRRVIDRVRAAGGVLHL
SFDVDVLDPSVAPGVGTTVPGGATYREAHLVMELLHDSRLVRSVDIVELNPFLDERGRTA
RVAVELLGSLLGMQITDRVTPSNAVLPEG
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgtcgcagaccgaagtcgctcacagcgatcctgcgcggcacgtcgcgctgctc
ggtgtgccgatcgagatcggcgccggcctgcgcggcacgctgatgggaccggccgcgctg
cgcaccgccggcatcggccgcgtactcgatcagctcggctttgcggtcgaagatcacggc
gacatgacgcgccccgcggctggcgacggcaacgatccggtgccggccaacgccaattac
tacagcgaggtgaagagctgggtcggggcgatctcggcccgcgcctacgaactggcgaga
tcgggcgcagtgccgctgttcatgggcggcgatcacagcctgtcgatgggctcggtcaac
ggcgtggcgcgctactggcaggaacaaagcaagccgctgttcgtgctgtggttcgatgcc
catgccgactacaacacgccggcgacgacgctgaccgccaacatgcacggcatgtcggcg
gcgttcctgtgcggcgagccggggctcgatcatctgctcggcgacgagccgcgggtgtcg
atcccgccgagccggctcgacctgttcggcatccgctcgatcgacccgctcgaaaaggag
ctggtgcggcaacgcgcgatcccggtggtcgacatgcgggcgatcgacgaattcggcgtc
ggcgtgctgatccgccgcgtcatcgaccgcgtccgtgccgccggcggggtgctgcatctg
tcgttcgacgtcgacgtgctcgatccttcggtcgcgcccggcgtcggcaccaccgtgccg
ggcggcgcgacctatcgcgaggcgcatctggtaatggagctgctgcacgactcgaggttg
gtgcgctcggtcgacatcgtcgagctcaacccgttcctcgacgaacgcggccgcaccgcc
cgcgtcgcggtcgaactgctcggcagcctgttgggcatgcagatcaccgaccgggtgacc
ccgagcaacgccgtgctgccggagggatga

DBGET integrated database retrieval system