KEGG   Rhodococcus pyridinivorans: Y013_01950Help
Entry
Y013_01950        CDS       T02974                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
rpy  Rhodococcus pyridinivorans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:rpy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Y013_01950
Enzymes [BR:rpy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Y013_01950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
410151..411509
Genome map
AA seq 452 aa AA seqDB search
MTPPTVAVVGGGISGLVAAYRLRRSLGAAARIVVLERSSRLGGKLRTVPLAGDPVDVGAE
AFIARRPEVVALVEELGLSAHIVHPSAARPLLYADARLHPLPAGTLMGIPASAQAVEGLV
DDETLARIAAEPTVPFHWDRDSDVSVADLVRSRFGEQVVQRSVDPLLGGVYSGLSDTAGV
RATVPMLAAALDAGATSLSDAVARALPPKSDAPVFGTLREGYGVLIQALVREADAEFLYG
TAASGLKRSGGRWSVDPLGEVDGVVLAVPAPDAARLLSDSVRSAAQCAAQIPLASSVVVA
LALPHDAGLPQNSGILVATGEELSAKAFTLSSRKWPHLAERPVALARASFGRFGDDALVD
ASEADLIALARADLATVTGVDAEPVAAFVQRWHGGLPQYREHHGEIVAAFEAEIAGIDGL
EVAGAMLHGVGVPACVATGTAAAARLTARMEG
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
gtgaccccgccgacggtcgcggtcgtcggcggtgggatcagcgggctcgtcgccgcgtat
cggctgcgtcgttcgctcggcgccgccgcccgcatcgtcgtgctcgagcgatcgtcgcgg
ctcggcggcaagctccgcacggtcccgctcgcgggtgatcctgtcgacgtcggcgccgag
gcgttcatcgcacgccgacccgaggtggtcgcgctcgtcgaggaactcggcctgagcgcc
cacatcgtccacccttcggctgcccgtccgctcctgtacgccgacgcgcgactgcatccg
ctgccggcgggcacgctcatgggcatccccgcctcggcgcaggccgtggagggtctcgtc
gacgacgagaccctggcgcgcattgccgccgaacccacagtgccgttccactgggaccgg
gactccgacgtctccgtcgcggatctcgtccgatcacgcttcggtgagcaggtggtgcag
cgcagcgtcgaccccctgctcggtggggtgtactcggggctgtccgacaccgcgggtgtc
cgtgccaccgtcccgatgctcgccgcggccctcgacgccggcgcgacgagcctgagcgac
gccgtcgcccgcgctctgcccccgaagtcggacgccccggtcttcgggacgctgcgcgag
ggctacggcgtgctgatccaagctctcgtccgcgaggccgacgccgagttcctctacggc
acagccgcatccggactgaagcgcagcggtggccggtggtcggtcgatccgctcggcgag
gtcgacggtgtggtgctcgccgtgcccgccccggacgccgcccggctgctctccgacagt
gtccgatccgccgcgcagtgcgccgcgcagatcccgctcgcctcgtcggtggtggtcgcg
ctcgcgttgccgcacgacgccggcctgccgcagaactccgggatcctcgtcgcgacgggg
gaggaactgtcggcgaaggccttcacgctgtcgagccgcaagtggccgcacctcgccgaa
cgtcccgtcgcactcgcgcgcgcgtcgttcggacggttcggcgacgacgcgctcgtcgac
gcgtccgaggccgacctgattgcgctggcccgcgcggatctcgcgaccgtcaccggagtc
gacgccgaaccggtggccgccttcgtgcagcggtggcacggcgggctgccgcagtaccgc
gaacaccacggcgagatcgtcgccgccttcgaggccgagatcgcagggatcgacggactc
gaggtcgccggcgcgatgctgcacggtgtgggtgtacccgcatgtgtcgcaacaggcacg
gctgcagccgcacgcctgactgcacgaatggaaggatga

DBGET integrated database retrieval system