KEGG   Rhodococcus pyridinivorans: Y013_02560Help
Entry
Y013_02560        CDS       T02974                                 

Definition
phosphoenolpyruvate carboxylase
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
rpy  Rhodococcus pyridinivorans
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rpy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Y013_02560
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Y013_02560
  Energy metabolism
   00680 Methane metabolism
    Y013_02560
Enzymes [BR:rpy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Y013_02560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
530798..533560
Genome map
AA seq 920 aa AA seqDB search
MTDTVPASATEPLREDIRLLGGILGNVIREQAGPETFDLVESARVESFRIRRSEIDRTEL
AERFAGVATDDLIPVARAFSHFGLLANLAEDLHRERRRALHVRAGDPPQDSSLAATYAKL
DAAGPGLDADTVTDALASALVAPVITAHPTETRRRTVFDVQTAVTELMRRRERTDEPAAL
EEIDRALYRHILTLWDTALIRLARLRIIDEVDNGLRYYDLALFDVVPALNAEVRRELRRR
WPDAAVLTEPLVRPGTWIGGDRDGNPNVDGEVVTTAANRACETALRHHLTELAALERELS
MSERTATISSALKKLADDSGDDNPAHSDEPYRRAVHGIRARLTATADRLLPGVDLPHTVR
IPCEPYATPARLHTDLNIVDASLRAGGATVIADDRLAHLRSAVEVFGFHLAPLDLRQNSE
VHENVVAELLSWAGVTDRYRDLPEDDKVALLTAELRIRRPLTTPDAHLSDETAKELGILR
AAADVVRRIGPAAIEHYIISMCTSVSDLLEVEVLLKEVGLLDLDRGYPRSTVQVIPLFET
IDDLRGGAATLTAALAVPEFRSLVDGHDGLQEIMLGYSDSNKDGGYLTANWALYRAELDL
VEAARTAGIRLRLFHGRGGTVGRGGGPSYDAILAQPPGAVQGSLRLTEQGEVIAAKYREP
VLARRNLEALVSATLESSLLDVEGLGKDAPEAYRILDELADLARAAYSRLVHETPGFVEY
FTTATPVSEIGALNIGSRPASRKQTKAISDLRAIPWVLSWTQSRVMLPGWYGTGTAVQDW
VAGDPDRLATLQDLYRRWPFFRSVLSNMAQVLAKSDLGLAARYSELVEDTELRERVFGSI
VDEHARTVDAYRQITGYDSLVADNPALERSLHNRFPYLEPLNHLQVELLRRFRAGEDTDR
VRRGIQITMNGLATALRNSG
NT seq 2763 nt NT seq  +upstreamnt  +downstreamnt
atgacggacactgtgcctgcctctgctaccgaacccctccgcgaggacatccgcctgctc
ggcggcatcctcggcaacgtcatccgtgagcaggcaggacccgagaccttcgacctggtc
gaatcggcccgggtggagagtttccggatccggcgctccgagatcgaccgcaccgaactc
gccgaacgcttcgccggcgtcgccaccgacgacctgattcctgtcgcccgggcgttcagc
catttcggtctgctcgccaatctcgccgaggatctgcaccgcgaacgacgtcgagccctg
cacgtgcgcgcaggcgacccaccgcaggacagcagcctcgccgccacctacgccaagctc
gacgccgccggtccgggtctcgatgccgacaccgtgaccgacgcgctcgcgtcggctctc
gtcgcccccgtcatcaccgctcatcccaccgagacccgccgacgcaccgtcttcgacgtc
cagaccgccgtcaccgaactcatgcggcgccgggagaggaccgacgaacccgccgcgctc
gaggaaatcgaccgcgccctgtaccggcacatcctgaccctctgggacaccgcgctcatc
cggctcgcgcgcctgaggatcatcgacgaggtcgacaacggtctgcgctactacgacctc
gcactgttcgacgtcgttcccgccctcaacgccgaagtacgacgcgaactccggcgacgc
tggcccgacgcggcggtgctcaccgaaccgctggtccggccgggaacctggatcggcggc
gaccgcgacggcaaccccaacgtcgacggcgaggtcgtcaccacggccgcgaatcgcgcc
tgtgagaccgcgctgcgacatcacctcaccgaactcgccgcgctcgaacgcgaactgtcg
atgtccgaacgcaccgcgaccatcagcagcgccctgaagaagctcgccgacgactcgggc
gacgacaatcccgcccacagcgacgagccgtaccgacgcgccgtacacggtatccgcgct
cgcctcaccgccaccgcggacaggctgctgcccggcgtggatctgccccacacggtgcgt
atcccgtgcgagccctatgccaccccggcccgcctgcacaccgacctgaacatcgtcgac
gcctcgctgcgcgccggcggagcgaccgtgattgccgacgatcgactcgcgcacctgcgc
agcgccgtcgaggtcttcggcttccacctcgcgccactcgacctgcgtcagaattccgag
gtccacgagaacgtcgtcgccgaactgctctcctgggcgggagtgaccgaccgctaccgc
gacctgccggaggacgacaaggtcgcgctgctcaccgcggagttgcggatccgccgcccg
ctcaccacccccgacgcccacctgtcggacgagacagccaaggaactgggcatcctgcgt
gctgccgccgacgtggtccgtcgcatcggaccggccgccatcgagcactacatcatcagc
atgtgcacctcggtgtccgatctgctcgaggtcgaggtcctgctcaaggaggtcgggctg
ctcgacctcgaccgcggctatccgcgcagcacggtgcaggtcatcccgctgttcgagacg
atcgacgacctgcgcggcggtgccgccacgctgaccgccgccctcgccgtgcccgagttc
cgcagcctcgtcgacggacacgacggactgcaggagatcatgctcggctactccgattcc
aacaaggatggcggttatctcaccgccaactgggcgctctaccgcgcggaactcgatctc
gtcgaggcggcgcgcaccgccgggatccggctgcgcctgttccacggtcgcggcggcacc
gtcggtcgcggtggcggaccgagttacgacgccatcctggcccagcctcccggcgcggtc
cagggctcgttgcgtctgaccgagcagggcgaggtcatcgccgcgaagtaccgcgaaccg
gtgctcgcccgccgcaacctcgaggcgctcgtctcggcgaccctcgagtcgagcttgctc
gatgtcgaaggcctcgggaaggacgcgccggaggcctaccgcatcctcgacgaacttgcc
gacctcgctcgcgccgcgtacagccgactcgtgcacgagacaccgggattcgtcgagtac
ttcaccaccgcgacgccggtctcggagatcggtgccctcaacatcggcagccgtcccgcc
tcccgtaagcagacgaaggcgatcagcgacctgcgggccatcccgtgggtgctctcgtgg
acccagagccgcgtgatgctccccggctggtacggcacgggaacggctgtgcaggactgg
gtggccggtgatccggaccggttggcgaccctgcaggatctctaccgtcgctggccgttc
ttccgttcggtgctgtcgaacatggcgcaggtgctcgccaagtccgatctcggcctggcc
gcccggtactccgaactcgtcgaggacaccgaactgcgcgagcgggtgttcggcagcatc
gtcgacgagcacgcccgtacagtcgacgcctaccggcagatcacgggctacgactcgctc
gtcgcggataatccggcgctcgagcggtcgctgcacaaccggttcccgtatctcgaaccg
ctcaaccacctgcaggtcgagttgctgcgccggttccgtgccggtgaggacaccgaccgt
gtccggcgcggtatccagatcacgatgaacggtctcgccacggcgttgcgcaacagcggt
tag

DBGET integrated database retrieval system