KEGG   Rhodococcus pyridinivorans: Y013_06815Help
Entry
Y013_06815        CDS       T02974                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
rpy  Rhodococcus pyridinivorans
Pathway
rpy00250  Alanine, aspartate and glutamate metabolism
rpy00410  beta-Alanine metabolism
rpy00430  Taurine and hypotaurine metabolism
rpy00650  Butanoate metabolism
rpy01100  Metabolic pathways
rpy01110  Biosynthesis of secondary metabolites
rpy01120  Microbial metabolism in diverse environments
rpy02024  Quorum sensing
Module
rpy_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:rpy00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Y013_06815
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Y013_06815
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Y013_06815
   00430 Taurine and hypotaurine metabolism
    Y013_06815
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Y013_06815
Enzymes [BR:rpy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Y013_06815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AHD20397
UniProt: V9XGG4
Position
complement(1425623..1427002)
Genome map
AA seq 459 aa AA seqDB search
MSESNAPAETLAPAFTGRLGTDPIPALRLPKSETDPEATYQFIHDELMLDGSSRLNLATF
VTTWMDPQAGRLMAETFDKNMIDKDEYPATAEIETRCVNMVAALFHAENLDPADPSSATG
VSTIGSSEAVMLGGLALKWRWREARRAAGKDASKPNLVLGSNVQVVWEKFCRYFDVEPKY
LPMEPGRYVITPEQVREAVDENTIGVVAILGTTFTGELEPVAEIAAALDELAASGGPDVP
LHVDAASGGFVVPFLHPDLEWDFRVPRVVSINVSGHKYGMTYPGIGFVVWRSKEHLPEDL
VFRVNYLGGDMPTFTLNFSRPGNQVIGQYYNFIRLGVAGYTQIMETLRDTALMLSKQISE
IENMAIITDGSAIPVISFEVTGDPGFTVFDISHELRARGFQVPAYTMPADAEDVAVLRIV
LREGFSRDIAHKLGEDIADVVGYLREGVGRGHTDQAFAH
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagtccaatgctccagccgagacactcgcacctgccttcaccggcagactcggt
accgacccgattcctgctctgcgacttcccaagtcggagaccgatccggaggcgacgtac
cagttcatacacgacgagctgatgctcgacggcagctcgcggctcaacctggcgaccttc
gtcaccacgtggatggatccgcaggcgggtcgtctcatggccgagacgttcgacaagaac
atgatcgacaaggacgagtatccggccacggcggagatcgagacccgttgcgtcaacatg
gtcgcggccttgttccacgccgagaacctcgatccggccgatccgtcgtcggccaccggc
gtctcgacgatcggttcgtccgaggccgtcatgctcggcggtctcgcgctcaagtggcgc
tggcgtgaggcccgtagggccgccggcaaggacgcgtcgaagccgaacctggtgctcggc
agcaacgtgcaggtggtgtgggagaagttctgccgctacttcgacgtcgagccgaaatac
ctgccgatggagcccggccgttacgtcatcacccccgagcaggtccgcgaagcggtcgac
gagaacaccatcggcgtcgtcgcgatcctcggcaccaccttcaccggtgaactcgagccg
gtggcggagatcgccgccgcgctcgacgagctcgcggcctccggcggtcccgacgtcccg
ttgcacgtcgacgccgcctccggtggcttcgtggtgcccttcctccatccggacctcgaa
tgggacttccgtgtgccgcgggtcgtgtccatcaacgtcagtggtcacaagtacggcatg
acctatccgggtatcggtttcgtcgtctggcgctcgaaggaacatctgcccgaggacctg
gtcttccgggtcaactacctcggtggcgacatgccgacgttcacgctcaacttctcgcgt
cctggtaaccaggtcatcggccagtactacaacttcatccggctcggtgtcgccgggtac
acgcagatcatggagaccctgcgcgacaccgcgctcatgctgtcgaagcagatctccgag
atcgagaacatggcgatcatcacggacggctccgccatcccggtcatctccttcgaggtg
acgggcgaccccggcttcacggtgttcgacatctcccacgaattgcgggcccgcggattc
caggttccggcctacacgatgccggccgacgcggaggacgtcgcggtcctgcgaatcgtg
cttcgcgagggcttcagccgggacatcgcccacaagctcggtgaagacatcgccgatgta
gtcggatatctccgcgagggtgtcggtcgcggccacaccgaccaggcattcgcacactga

DBGET integrated database retrieval system