KEGG   Rhodococcus pyridinivorans: Y013_06890Help
Entry
Y013_06890        CDS       T02974                                 

Definition
glycogen synthase
Orthology
K16150  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
rpy  Rhodococcus pyridinivorans
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:rpy00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Y013_06890
Enzymes [BR:rpy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     Y013_06890
Glycosyltransferases [BR:rpy01003]
 Polysaccharide
  Storage polysaccharide
   Y013_06890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1443883..1445130
Genome map
AA seq 415 aa AA seqDB search
MKILLVSWEYPPVVVGGLGRHVHHLATELAAAGNEVVVLSRRPTGTDASTHPTISHIADG
VLVVAVAEDAPHFDFGEDMIAWTLAMGHAMVRAGIGLTRGGIGEGWYPDVVHAHDWLVAH
PAIALAEYFDVPLVSTLHATEAGRHSGWLSGRINRQVHSVEWWLANESDRLITCSASMHD
EVTELYGPDLPEISVIRNGIDITTWSYRDREPRPGPARLLYVGRLEYEKGVQDAIAALPR
IRRSHPGTTLVVAGEGTQFEWLREQARVHRVARSVSFLGNLDHTELLGWLHGADAIVLPS
RYEPFGIIALEAAAAGTPLIASTAGGLGEAVVDGVTGLSFRPGDVAGLVSAVRETLDDPE
AARVRARAARARLTDDFDWRRVAEETAQVYSSAKRRVRHPLARPTVPQRPLPDRG
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgaagattctgctcgtctcatgggagtacccacccgtcgtcgttggcggcctgggcaga
cacgtccatcatctcgccaccgaactcgccgcggcgggcaacgaggtggtggtgctgtca
cgtcgcccgaccggcaccgatgcgtcgacccaccccacgatcagccacatcgccgacggc
gtgctcgtggtggcggtcgcggaggacgcaccccacttcgacttcggcgaggacatgatc
gcctggacgctggcgatgggccacgcgatggtccgcgccgggatcgggctgacccgcggc
ggcatcggcgaaggttggtatccggacgtcgtccacgcccacgactggctcgtcgcccac
cccgcgatcgcgctggccgagtacttcgacgtgccgctcgtgtcgaccctgcacgcgacc
gaggccggtcgccacagcggttggctgtcgggccggatcaaccgccaggtgcattccgtc
gagtggtggctcgccaacgaatccgaccgtctcatcacgtgttcggcgtcgatgcacgac
gaggtcaccgagttgtacggtccggacctgccggagatctccgtgatccgcaacggcatc
gacatcaccacctggtcgtaccgcgaccgcgaaccgcgtcccgggccggcacgactgctg
tacgtcggccgcctcgaatacgagaagggtgtgcaggacgcgatcgccgcgctcccccgc
atccgccgctcgcatcccggcacgaccctcgtggtcgccggtgagggcacccagttcgag
tggctgcgcgagcaggcacgcgtacaccgcgtcgcacgctcggtgagtttcctcggcaac
ctcgaccacaccgaactgctcggctggctgcacggcgccgacgcgatcgtgctgccgagc
cgctacgagccgttcggcatcatcgccctcgaggccgccgcagcgggtaccccgctcatc
gcgtccaccgccggcggcctgggcgaagccgtggtcgacggcgtgaccggactgtcgttc
cggcccggcgacgtggccggactcgtctcggccgtccgggaaaccctcgacgatcccgag
gccgcccgagtgcgcgcgcgggcggcccgggcacgactgaccgacgacttcgactggcgc
cgcgtcgccgaggaaaccgcgcaggtctactcgtcggcgaagcggcgggtgcgtcacccg
ctcgcacgccccacggtcccccaacgtcccctcccggaccgcggatga

DBGET integrated database retrieval system