KEGG   Rhodococcus pyridinivorans: Y013_19050Help
Entry
Y013_19050        CDS       T02974                                 

Definition
4-aminobutyrate aminotransferase
Orthology
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
rpy  Rhodococcus pyridinivorans
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:rpy00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Y013_19050
   00650 Butanoate metabolism
    Y013_19050
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Y013_19050
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Y013_19050
Enzymes [BR:rpy01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Y013_19050
Amino acid related enzymes [BR:rpy01007]
 Aminotransferase (transaminase)
  Class III
   Y013_19050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4068755..4069996
Genome map
AA seq 413 aa AA seqDB search
MTRLSPRLLQATPVTVDHAEGCYIHGTDGRRYLDFTAGIGVTSTGHCHPHVVEAARRQIG
SLIHGQYTTVMHRPLLELTERLGTVLPEGLDSLFFANSGSEAVEAALRLARQATGRPGIV
VFHGGFHGRTVAAATMTTSGTRFSAGFSPLMGGVHVAPFPTAYRYGWSEEEATDFALQEL
DYLFATLVAPDEIAAFVVEPVLGEGGYVPGNTRFFQGLRQRADEHGILLVFDEIQTGFGR
TGKFFGHQHFDVRPDIITIAKGLASGFPLSGIAASEELMERARPGSQGGTYGANAVSCAA
AVATLDVIEKEGLVDNAAVRGRELLSGARENTTDAIGDVRGLGLMVGLEFTADGAPDRER
ATAAQQLAAQKGLLLLTCGAHMNVVRMIPPLIVTAQQIEDALGTWSEVLAEVR
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtctttcaccccgcctgctgcaggcaacgcccgtcaccgtcgaccacgccgag
gggtgctacatccacggcaccgacggacgtcggtatctcgacttcaccgccggcatcggc
gtcacgagtaccggccactgtcacccgcacgtcgtcgaggccgcccgccggcagatcggc
tcgctgatccacgggcagtacacgaccgtgatgcaccggcccctgctcgaactcaccgaa
cgcctgggcacggtgctccccgaaggactcgactcgctgttcttcgccaattcgggcagc
gaggcagtcgaggcggcgctgcgtctggcccgccaggcgacagggcgacccggaatcgtc
gtcttccacggcggtttccacggccgtaccgtcgccgccgccacgatgaccacctccgga
acccgtttctccgcagggttctcgccgctcatgggcggtgtacacgtcgctcccttcccc
acggcctatcgctacggctggtcggaggaggaagcgaccgatttcgccctgcaggaactg
gactacctgttcgcgaccctcgtggcgccggacgagatcgcggccttcgtcgtcgaaccg
gtcctgggcgagggcggttacgtccccggcaacaccaggttcttccagggactgcggcag
cgggccgacgaacacggcatcctgctcgtcttcgacgagatccagaccggattcgggcgg
accggaaagttcttcgggcatcagcacttcgacgtgcgacccgacatcatcaccatcgcc
aagggcctcgcgagcggtttcccgctgtcgggtatcgccgcctccgaggaactcatggaa
cgcgcccgtccgggatcgcagggcggcacgtacggggcgaatgcggtctcgtgcgcggcg
gccgtggccactctcgacgtgatcgagaaggaggggctcgtcgacaatgccgccgtgcgt
ggacgtgaactgctctccggcgcacgggagaacacgaccgatgccatcggtgacgtgcgc
ggcctcggtctcatggtgggcctcgagttcaccgcggacggagcacccgaccgggaacgg
gcgaccgcagcgcaacaactcgccgcccagaagggtttgctgctgttgacctgcggtgca
cacatgaacgtggtgcgcatgatccccccgttgatcgtcaccgcccagcagatcgaggac
gcgctcgggacctggtccgaggtcctcgccgaggtccgataa

DBGET integrated database retrieval system