KEGG   Rhodococcus pyridinivorans: Y013_19595Help
Entry
Y013_19595        CDS       T02974                                 

Definition
sugar kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
rpy  Rhodococcus pyridinivorans
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:rpy00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Y013_19595
Enzymes [BR:rpy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Y013_19595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4174616..4175461
Genome map
AA seq 281 aa AA seqDB search
MAVVGSLNLDLTVVVARAPEEGETVLGRHLRTYPGGKGANQAIGAARLAPTAIVGAVGSD
HAADVLRGVQQRAGVDTSHLRTTPGPTGRAVILVSDDGQNRIVVVPEANSLLEAEDVTAA
LDALDPAVVLTQLELLPAVTWAAAQWARDHDRRFVLNPSPVIDLDEYVLAGADPLVLNEQ
EALHYAGLPAGTPFDAIVTRLLEQVRTVVITRGGEDVVVGTEDAIEHLRVPQVDVVDTTG
AGDHFAGTLAALLGTGEDLFAAARRASADAARLVASRRSDR
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
gtggcggtcgtgggatcgctgaacctcgacctgacggtcgtcgtggcacgtgctcccgaa
gaaggtgagacggtactcggccggcatctgcgcacctatccgggaggcaagggcgcgaac
caggccatcggtgctgcccgcctggctcccaccgccatcgtcggcgcggtgggcagcgat
catgccgctgacgtactgcgcggcgtgcaacagagggcaggggtcgacacctcccatctg
cgcaccacaccgggcccgaccggccgggccgtcatcctcgtctccgacgacgggcagaac
cggatcgtcgtcgtacccgaggccaattcgttgctcgaggccgaggacgtgaccgcagca
ctcgatgccctcgatcccgcggtggtgctcacccaactcgagctgctccccgcagtgacc
tgggccgccgcccagtgggcgcgcgatcacgaccgccggttcgtgctcaatccgagcccg
gtgatcgacctggacgaatacgtcctcgccggcgccgatccgctcgtactcaacgagcag
gaagccctgcactacgcgggtcttcccgcagggacccccttcgacgcgatcgtgacccgc
ctgctcgaacaggtgcgcaccgtggtgatcacccgtggtggggaggacgtcgtggtcgga
accgaggacgcgatcgaacatctgcgggtcccgcaggtcgacgtcgtcgacacgacgggg
gcgggcgatcatttcgccggcacgctcgccgcgttgctcggcacgggggaggacctgttc
gcggcagcgcgccgggcatcggccgacgctgcccggctggtcgcatcccgccgctccgat
cgctga

DBGET integrated database retrieval system