KEGG   Rhodococcus pyridinivorans: Y013_20155Help
Entry
Y013_20155        CDS       T02974                                 

Definition
(GenBank) succinate dehydrogenase
  KO
K16051  3-oxo-5alpha-steroid 4-dehydrogenase [EC:1.3.99.5]
Organism
rpy  Rhodococcus pyridinivorans
Pathway
rpy00984  Steroid degradation
rpy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rpy00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Y013_20155
Enzymes [BR:rpy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With unknown physiological acceptors
    1.3.99.5  3-oxo-5alpha-steroid 4-dehydrogenase (acceptor)
     Y013_20155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 DAO FAD_oxidored Pyr_redox_2 Thi4 AlaDh_PNT_C HI0933_like NAD_binding_8 GIDA FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AHD22776
UniProt: V9XH58
Position
complement(4295975..4297438)
Genome map
AA seq 487 aa AA seqDB search
MSTDLHPLPAGSVSTWDHEADVVVAGYGIAGVSASIEAARAGADVLVLERTSGWGGAASL
SGGIVYLGGGTPLQKALGFDDTPENMKAFMLAALGPGADEAKIIEYCEGSVEHYEWLVDN
GVVFKESFWGEPGWEIPGDDGLMYSGGENSAPFNEIATPAPRGHVPQMTDKRTGEKGGGY
MLMQPLSQVAESLGVRAEYDVRVQRLIVDGDGRVVGLTAKQYGKDVHIRARRGVVLATGS
FAYNQEMVESYAPQLSGRPGAAIEEHDGRAIRMAQALGADLAHMDATEVAFFGDPQLMAR
GILVNGRGQRYVPEDTYPGRIGQLTLLKNDNQAYLIIDEQAYEEGCAATSSTPFFRFRPK
WVAETVAELESDMELPAGTLQATVEVYNRHAENGSDPVLGKKSEWVKPIGSPIAALDLRN
CTAGFTLGGLRTSVNSEVLHVSGDPIPGLFAAGRCTSGVCAWGYASGTSLGDGSFFGRRA
GLSAAKG
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgatctccacccccttcccgccggcagcgtctccacctgggaccacgaagcc
gacgtcgtcgtcgccggttacggcatcgccggtgtctcggcgtcgatcgaggccgcccgc
gcgggtgccgacgtgctcgtgctcgagcggaccagcggttggggcggcgcggcctcactg
tcgggcggcatcgtctacctcggcggcggcaccccgctgcagaaggccctcggattcgac
gacacgcccgagaacatgaaggcgttcatgctcgccgcgctcgggccgggcgccgacgaa
gcgaagatcatcgagtactgcgagggcagcgtcgaacactacgagtggctcgtggacaac
ggcgtggtgttcaaggagagcttctggggcgaacccgggtgggagatccccggtgacgac
ggcctgatgtactccggcggcgagaactccgcgcccttcaacgagatcgcgacgcccgcc
ccgcgcggccacgtcccgcagatgaccgacaagcggaccggcgagaagggtggcgggtac
atgctcatgcagccgctctcccaggtcgccgaaagcctcggtgtgcgtgccgaatacgac
gtgcgggtgcagcggttgatcgtcgacggcgacggacgcgtcgtgggcctgacggccaag
cagtacggcaaggacgtccacatccgggcccgccgcggcgtcgtcctcgcgaccggcagt
ttcgcgtacaaccaggagatggtcgagtcgtacgcgccgcagctcagcggtcgcccgggt
gcggcgatcgaggagcacgacggccgtgcgatccgcatggcgcaggcgctcggcgccgat
ctcgcgcacatggacgccaccgaggtcgccttcttcggcgacccgcagttgatggcccgc
ggcatcctcgtcaacggccgcggtcagcggtacgtccccgaggacacctatccgggccgt
atcggtcagctcacgctgctgaagaacgacaaccaggcctatctgatcatcgacgaacag
gcgtacgaggagggttgtgcggcaacgagttcgacgcccttcttccggttccgtccgaag
tgggtcgcggagaccgtcgccgaactcgaatccgacatggaactgcctgccgggacgttg
caggcgaccgtcgaggtctacaacaggcacgcggagaacggcagcgatccggtgctgggc
aagaagagcgagtgggtcaagcccatcggcagcccgatcgccgcgctcgatctccgtaac
tgcacagcaggtttcacgctcggcggtctgcgcacctcggtgaactcggaagtgctgcac
gtgtccggcgatccgatccccggcctgttcgccgccggtcgctgcacgtcgggcgtgtgc
gcgtggggttatgcgagcggcacgtcgctgggggacggaagcttcttcggtcgccgcgcc
ggtctgtcggccgcgaagggctga

DBGET integrated database retrieval system