KEGG   Rhodococcus pyridinivorans: Y013_20295Help
Entry
Y013_20295        CDS       T02974                                 

Definition
trehalose synthase
Orthology
K05343  
maltose alpha-D-glucosyltransferase/ alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
rpy  Rhodococcus pyridinivorans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:rpy00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(4328831..4330654)
Genome map
AA seq 607 aa AA seqDB search
MPDPSDRVPEYEHTEDGHLVESRAEDFAHARSLPVDPDWFKTAVFYEVLARAFNDSNNDG
TGDLRGLTEKLDYIAWLGADCIWLPPFYDSPLRDGGYDIRDFRAVLPEFGTVEDFVTFLD
EAHKRGIRVITDLVMNHTSDTHAWFQESRSDPDGPYGDFYVWSDVDDRYQEARIIFVDTE
TSNWTWDPVRKQYYWHRFFSHQPDLNYDNPEVQDAMLDVLRFWLDLGIDGFRLDAVPYLF
EREGTNCENLPETHAFLKKCRAVMDAEYPGRVMLAEANQWPTDVVEYFGEPEIGDECHMA
FHFPLMPRIFMAVRRQNRFPISEILAQTPPIPKTAQWGIFLRNHDELTLEMVTDEERDYM
YAEYVTDPRMRANIGIRRRLAPLLENDRNQLELFTALLLSLPGSPVLYYGDEIGMGDNIW
LGDRDAVRTPMQWTPDRNAGFSRADPGRLYLPVIMDPTYGYQAVNVESQMNSTNSLLHWT
RRMIQVRKQHPAFGKASFTELGSANPAILSYLREMSPGPERNYSDVILCVNNLSRYPQAV
VLDLSRFAGWIPVELTGSVPFPTITEEGYMITLPGHGFFWFALQPDPSKEGPGEHPVSSE
AEAAVQP
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgccggatccgtccgaccgagtacccgaatacgaacacaccgaagacggtcatctcgtc
gagagccgggcggaggacttcgcccatgcgcgcagcctgcccgtcgacccggactggttc
aagaccgcggtgttctacgaggttctcgcccgcgctttcaacgactcgaacaacgacggc
accggcgacctacgggggctgaccgagaaactcgactacatcgcatggctcggcgccgac
tgcatctggctgccgcccttctacgattcaccgctccgcgacggcggctacgacatccgc
gacttccgggcggtgctaccggaattcggcacggtcgaggacttcgtcaccttcctcgac
gaggcgcacaaacgcggtatccgcgtcatcaccgacctcgtcatgaaccacacgtccgac
acgcacgcgtggttccaggaatcccggagcgaccccgacgggccgtacggcgacttctac
gtgtggtcggatgtcgacgaccgataccaggaagcccgcatcatcttcgtcgacaccgag
acgtccaactggacgtgggatccggtgcgcaagcagtactactggcaccggttcttctcg
caccagcccgacctgaactacgacaaccccgaagtacaggacgcgatgctcgacgtcctg
cgcttctggctcgatctcggcatcgacgggttccgcctcgacgcggtcccctatctgttc
gagcgcgaggggaccaactgcgagaacctccccgagacgcacgccttcctcaagaagtgc
cgtgcggtgatggatgccgaatatcccggccgggtaatgctggcggaggcgaaccagtgg
cccaccgacgtcgtcgagtacttcggcgaacccgagatcggcgacgagtgccacatggcc
ttccacttcccgctgatgccgcgcatcttcatggcggtgcggcgacagaaccgtttcccg
atctcggagatcctcgcccagaccccgccgatcccgaagaccgcccagtggggcatcttc
ctccgcaaccacgacgagctgaccctcgagatggtgacggacgaggaacgcgactacatg
tacgccgagtacgtcaccgacccgcggatgcgcgccaacatcggcatccgccgtcgtctg
gcgccgttgctggagaacgaccgcaaccagctcgagctcttcaccgctctgttgctgagc
ctgccgggctcccccgtcctgtactacggcgacgagatcggcatgggcgacaacatctgg
ctcggcgaccgcgacgcggtgcggaccccgatgcagtggacccccgaccgcaacgcgggc
ttctcccgcgccgacccgggccggctgtacctgccggtgatcatggatcccacctacggg
taccaggcggtcaacgtcgaatcgcagatgaactcgacgaactcgctgctgcactggacg
cgtcgcatgatccaggtccgcaagcagcatccggccttcggcaaggcctcgttcaccgaa
ctcggcagcgcgaatcccgcgatcctgtcctatctgcgcgagatgtcgcccggcccggaa
cgcaactacagcgacgtcatcctgtgcgtgaacaacctgtcgcgctatccgcaggcggtc
gtcctcgatctgtcgcgtttcgccgggtggatcccggtggagctgaccgggtccgtcccg
ttcccgacgatcacggaggagggttacatgatcaccctgcccggtcacggattcttctgg
ttcgccctgcaacccgatccgtcgaaggagggaccgggcgaacacccggtgagcagcgaa
gcggaagcggcggtgcagccgtga

DBGET integrated database retrieval system