KEGG   Rickettsia prowazekii Dachau: MA3_00875Help
Entry
MA3_00875         CDS       T01790                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rpz  Rickettsia prowazekii Dachau
Pathway
rpz00020  Citrate cycle (TCA cycle)
rpz00310  Lysine degradation
rpz01100  Metabolic pathways
rpz01110  Biosynthesis of secondary metabolites
rpz01120  Microbial metabolism in diverse environments
rpz01130  Biosynthesis of antibiotics
rpz01200  Carbon metabolism
Module
rpz_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rpz00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MA3_00875
  Amino acid metabolism
   00310 Lysine degradation
    MA3_00875
Enzymes [BR:rpz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MA3_00875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N
Motif
Other DBs
NCBI-ProteinID: AFE51530
Position
complement(210973..212178)
Genome map
AA seq 401 aa AA seqDB search
MSVKIIIPSLGESVTEATIAKWYKKLGDSVKTDELLLEIETEKVTLEVNAPCNGTIEKIA
KTDGANVTVGEEIGEINEVVDTDTACTNNNSYKKQAIVQHDSEQIVDKPASSSNILAPSV
QKLVTENKLDPNNIKGTGRGGRITKCDVLETINTTPVTIETPALNKTNEERTQRVRMSRL
RKTIAQRLKDSQNTAAILTTFNEIDMSKVIALRNQYKEEFEKKHTVKLGFMSFFVKATIE
ALKLIPSINAEIDGDDLLYKNYYDIGVAVGTDQGLVVPVVRDADKMGFADVEQAIGDLAK
KAREGKLSMSDLSGGTFSISNGGVYGSLLSTPIINPPQSGILGLHKTEERAVVIDGKIEI
RPMMYIALSYDHRIIDGKEGVSFLVKIKNLIENPEKLLLNL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgagtgttaaaattataataccatcgcttggggaatcagtaacagaagcaactattgct
aaatggtataagaaattaggtgattcagttaaaactgatgaattactattagaaatcgaa
actgaaaaagtgactttagaagttaatgctccttgcaacggtactatagagaaaatagca
aaaactgatggtgcaaatgtaacagttggcgaagaaataggtgaaatcaatgaagttgta
gatacagatactgcttgtactaataataattcttataaaaagcaagcaattgtacaacac
gattcagaacagattgtagataaacctgcttcttctagtaatattcttgctccttcagta
caaaaattagtgaccgaaaacaagcttgatccaaataatattaaaggaactggtagaggt
ggtagaattactaaatgtgatgtgctagaaaccataaacactacacctgttactattgag
actcctgcactaaataaaactaatgaagaaagaacacaacgcgtacgtatgtcacgcttg
cgtaaaactattgcacagcgtttaaaagattcacaaaatactgcagctattttgactact
tttaacgaaatcgatatgtcaaaagtcattgctttgcgtaatcaatataaagaagagttt
gagaaaaagcatactgtaaaacttggatttatgtcattttttgttaaagcaacaattgaa
gctttgaagcttattccatcaataaatgcggaaatagatggagatgatttattatataag
aactattacgatataggtgttgcagtaggaacagatcaaggacttgttgtaccagttgtt
agggatgccgataaaatgggttttgctgatgtagagcaagctatcggagatttggcaaaa
aaagctcgtgaggggaaactttctatgtctgatttgtcaggtggtacattctcaatttct
aatggaggagtatatggctcattattatctacaccgattattaatcctcctcaatcaggt
attctaggattacataaaactgaggaaagagctgtagttatagacggtaaaattgaaata
cgtccaatgatgtatatagccttatcttacgatcatcgtataattgatggaaaagaggga
gtatcattcttggtaaaaattaaaaatcttattgagaatcctgagaagttattattaaac
ttgtag

DBGET integrated database retrieval system