KEGG   Rickettsia prowazekii Dachau: MA3_01245Help
Entry
MA3_01245         CDS       T01790                                 

Definition
(GenBank) cytochrome c
  KO
K08738  cytochrome c
Organism
rpz  Rickettsia prowazekii Dachau
Pathway
rpz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rpz00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MA3_01245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 DUF5326
Motif
Other DBs
NCBI-ProteinID: AFE51602
Position
complement(308103..308630)
Genome map
AA seq 175 aa AA seqDB search
MTGKELNKIVAAILFASLIAMIVGFIANILYKPNLHVLHRGYSIAIQKSSSNESATVIAQ
ESVNIQELMKTANANHGREIAKKCLMCHSLDKDGPNKLGPHLWNIVGRPKASITDYKYSF
AISKLGGVWDDENLFAFLHKPSSYAPGTKMSFAGISKPQDIADVILFLKNYVHDQ
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgactggaaaagagttaaataaaattgttgcagcaatcttatttgctagtttaattgct
atgattgttggatttattgcaaatatattatataaaccaaacttacatgttttacatcgc
ggttatagcattgcaattcaaaaatcatcaagcaatgaaagtgctacagtaatcgcgcaa
gaatcggtaaatatacaggaattgatgaaaactgctaacgcaaatcatggtcgtgaaata
gcaaaaaaatgtttaatgtgtcattctcttgacaaagacggtccaaataaactaggacca
catctttggaatatagtaggaagaccaaaagcaagcataacagactataaatactccttt
gctatatcaaaacttggaggcgtatgggatgatgaaaatttatttgcttttttacacaaa
ccaagtagctatgccccaggaactaaaatgtcctttgcaggtatctcaaaaccacaagac
atagctgatgtaatattatttttaaaaaactatgttcatgatcaataa

DBGET integrated database retrieval system