KEGG   Rickettsia prowazekii Dachau: MA3_01460Help
Entry
MA3_01460         CDS       T01790                                 

Definition
3'-phosphoadenosine 5'-phosphosulfate 3'-phosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
rpz  Rickettsia prowazekii Dachau
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:rpz00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
362753..363541
Genome map
AA seq 262 aa AA seqDB search
MNDNLINALKDLIINTGKVALDIKKTGILIDTKSDGSVVTNADQEISKIIYQTLRSLTSQ
IAIVCEEQPLPILNSDTFWLIDPIDGTRSYVEGKNTYTVNIGLIENGFPTIGLIYHPETA
KLYYTDVNGRLKIEQNSQEIFVNYSPKHKEPNAVVGFYNSNKATKEFLRSYSFGKINAIS
SSIKLCLIAEGKADIYPKFGQTMEWDIAAGHALIKASGGNILDCDGQEVTYGKANFANPH
FFACSKYWLEMDSVFVSTKSLL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaatgacaatttaattaatgctttaaaagatttaattattaatactggtaaggttgcg
ctagatatcaaaaaaacaggaatattgattgatactaaatcagatggttctgtagtcact
aatgcagatcaggaaattagtaaaataatttatcaaactttacgaagcttaacatctcaa
atagcaatagtatgtgaagagcagccactacctatattaaatagtgatactttttggtta
atagatcctattgatgggacacggagctatgtagagggtaaaaatacctatacagtaaat
ataggccttattgaaaatggttttccgactatcggtttgatatatcatcctgaaactgcg
aagctgtattatactgatgtaaacggtcgattaaaaatcgaacaaaattctcaagaaata
tttgtgaattattcacctaaacataaagagcctaatgctgttgtaggtttttataattca
aataaagctactaaagaatttttaaggagttattcattcggtaaaataaatgcaataagc
agttcaattaaattatgcttaattgccgaaggtaaagctgatatatatcccaagtttggc
caaactatggagtgggatatagcagcaggtcatgcactaattaaagctagcggcggtaat
attttagattgcgatggtcaagaagttacttacggtaaagcaaattttgctaatcctcat
ttttttgcatgcagtaaatattggttggaaatggattctgtttttgtgtctactaaatcg
ttattgtaa

DBGET integrated database retrieval system