KEGG   Rickettsia prowazekii Dachau: MA3_02570Help
Entry
MA3_02570         CDS       T01790                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rpz  Rickettsia prowazekii Dachau
Pathway
rpz00010  Glycolysis / Gluconeogenesis
rpz00020  Citrate cycle (TCA cycle)
rpz00620  Pyruvate metabolism
rpz01100  Metabolic pathways
rpz01110  Biosynthesis of secondary metabolites
rpz01120  Microbial metabolism in diverse environments
rpz01130  Biosynthesis of antibiotics
rpz01200  Carbon metabolism
Module
rpz_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rpz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MA3_02570
   00020 Citrate cycle (TCA cycle)
    MA3_02570
   00620 Pyruvate metabolism
    MA3_02570
Enzymes [BR:rpz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MA3_02570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 CAT QRPTase_N
Motif
Other DBs
NCBI-ProteinID: AFE51859
Position
complement(652910..654136)
Genome map
AA seq 408 aa AA seqDB search
MPIKILMPALSPTMREGNLARWLKKEGDKVNPGEVIAEIETDKATMEVESVDEGILAKII
IPQNSQNVPVNSLIAVLSEEGEDKADIDSFIAQNNSVSLSLKTDATLKKSNDSITNVEGI
KHDSNKIFASPLAKRLAKIGDIRLENVQGSGPHGRIVKQDILSYDSSTSSNKIVYRDTEE
YRSVPNNNIRKIIAKRLLESKQTVPHFYLSIECNVDKLLDVREDINKSFSEDKVTKISVN
DFIILAVAKALQEVPNANASWSEDAIRYYNNVDISVAVAIENGIVTPIVKDANKKNIIEL
SREMKTLIKKAKDNKLTPIEFQGGGFTISNLGMYGIKNFNAIINTPQSCIMGVGASTKRA
IVKNDQIIIATIMDVTLSADHRVIDGAVSAEFLASFKRFIENPVLMLI
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgccgattaaaattttaatgcctgctttgtctccaactatgagagaggggaatctagct
aggtggttaaaaaaagaaggggacaaagtaaatcccggggaagtaattgctgaaattgaa
actgataaagcaacaatggaagtagaatcagtagacgaaggtatacttgccaaaataatt
attccgcaaaatagtcaaaatgtacctgttaactctttaattgcagtattaagtgaagaa
ggagaagataaagcagatattgattcgtttattgcacaaaataatagtgtatcactatca
ctaaaaacagatgctactcttaagaaatcaaatgatagcataactaatgtagaaggtata
aaacatgattccaataaaatatttgcctcaccacttgcaaaaaggcttgcaaaaattgga
gatattagacttgagaatgtgcaaggtagtggaccgcacggtagaatagtcaaacaagat
atattatcatatgattctagcacttcttctaataaaatagtgtatagagatactgaagaa
tatcgttcagtaccaaataataatatccgaaagattatagccaagcgtttgcttgaatcg
aaacaaacagttccacatttttatttatctatagaatgtaatgttgataaattattagat
gtaagggaagacattaataaatctttttctgaagataaagtaacaaagatatcggttaat
gattttataattttagctgtagccaaagctttacaagaagtgccaaatgctaatgctagc
tggtcagaagatgcgattagatattacaataatgtcgatatttcagtggcggtagcaatc
gagaacggtattgttacaccgatagttaaagatgctaacaaaaagaatattatagaacta
tctcgtgaaatgaaaacattaataaagaaagcaaaagataataaattaactcctatagaa
tttcagggtggaggatttacaatttctaatctcggaatgtacggtattaagaattttaat
gctattattaatacaccgcaaagttgtataatgggtgtcggagctagtacaaaacgtgct
atagtcaagaatgatcaaataatcatcgcaacaattatggatgttactctttctgccgat
caccgagtaatagacggagcagtaagtgctgagttcttggcatcatttaaaaggtttata
gagaatcctgttttgatgttgatataa

DBGET integrated database retrieval system