KEGG   Rickettsia prowazekii Dachau: MA3_02710Help
Entry
MA3_02710         CDS       T01790                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
rpz  Rickettsia prowazekii Dachau
Pathway
rpz00071  Fatty acid degradation
rpz00280  Valine, leucine and isoleucine degradation
rpz00281  Geraniol degradation
rpz00310  Lysine degradation
rpz00362  Benzoate degradation
rpz00380  Tryptophan metabolism
rpz00640  Propanoate metabolism
rpz00650  Butanoate metabolism
rpz00903  Limonene and pinene degradation
rpz00930  Caprolactam degradation
rpz01040  Biosynthesis of unsaturated fatty acids
rpz01100  Metabolic pathways
rpz01110  Biosynthesis of secondary metabolites
rpz01120  Microbial metabolism in diverse environments
rpz01130  Biosynthesis of antibiotics
rpz01200  Carbon metabolism
rpz01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rpz00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MA3_02710
   00650 Butanoate metabolism
    MA3_02710
  Lipid metabolism
   00071 Fatty acid degradation
    MA3_02710
   01040 Biosynthesis of unsaturated fatty acids
    MA3_02710
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MA3_02710
   00310 Lysine degradation
    MA3_02710
   00380 Tryptophan metabolism
    MA3_02710
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MA3_02710
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MA3_02710
   00281 Geraniol degradation
    MA3_02710
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MA3_02710
   00930 Caprolactam degradation
    MA3_02710
Enzymes [BR:rpz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     MA3_02710
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MA3_02710
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     MA3_02710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_2 ECH_1 NAD_Gly3P_dh_N NAD_binding_2 UDPG_MGDP_dh_N ApbA NAD_binding_8 Pyr_redox_2 DAO F420_oxidored Epsilon_antitox
Motif
Other DBs
NCBI-ProteinID: AFE51887
Position
complement(696863..699025)
Genome map
AA seq 720 aa AA seqDB search
MQNEIKKVCVIGAGVMGSGIAALIANSSHQVVLLDILDKDSNDPNKIVKNSVKNLHKQKL
SPLSFPDKVNFITIGNLEHDLDLIKECNLVIEVIVEKLEIKHQLYNKIIPYLKEDAIIAS
NTSTLPLKKLKVNLPNNIKSRFVITHFFNPPRYMELVELIIDHTIKDEVIEKVSVFLTKM
LGKTIIKCNDTPGFIANRVGCFLLELVVHKAIAQNLNFVTIDQIFSRCLGLPNTGIFGLY
DLIGHDVMKLISSSLISALPKSDDYHRIYTNTKVFDKMIEHNLIGRKGEGGFYRLSVSNG
KKIKEVINISDLSYHPVQKVDISFNSLNELLSSNSIYGKFFSEIITEFYIYLTSLVPSVT
NNIYDIDTTMKLGYSWHYGPFELLTIAVKNGWNLIIKNADLMNIPLPKYLASKEYQKIDK
QKFNSKKDFLQESKIVLSNDSANLIHYCENLVFVITTKMNSLNHNVFYLLQEAVSKAENY
GKNLYIYPQGNNFSAGADLKLILSYIQDGNFHNLENLLKLGQQTMRYLKYSSVHIISCAR
GVALGGGCELLLNSSYIVANQELNAGLIELGVGLIPGWTGVTEMFARSNGNKTKLIRNIK
NIIEQNKTSSADYFKADYGIKNMQVNMNKHYILDDALKLRISKKIVSIPNKITLPKINIV
SEIDTSKYNELQNKVLNKFQNIIDKHNEISEAELLTYEREMFLELAKTPQTIEKLQAIVG
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatgaaataaaaaaagtttgtgttattggtgcaggagtcatgggttcaggcatt
gcagcgttgattgctaattcctctcatcaagtagttctgcttgatattcttgataaagat
tctaatgatcctaataaaatagtaaaaaattctgtaaagaatttgcataaacaaaagctt
tctcctttatcttttccagataaagtcaatttcattacaataggtaatttagaacatgat
ttagatttaattaaagaatgtaatttagtaattgaagttatcgttgagaagttagaaatc
aaacatcaattatataataaaattataccttatcttaaagaagacgcaattatcgcttct
aacacctctacattgccgctaaaaaaactcaaagtgaatttaccaaataatataaagtca
agattcgttattacacatttctttaatccaccgcgatatatggaattggttgaattaatt
atagaccatacaatcaaggatgaggtcatagaaaaagtatcagtgttcttaactaaaatg
cttggtaaaactataataaaatgtaatgatacacctggttttattgctaatagagtagga
tgttttttacttgagttagtagtccacaaagcgatagctcaaaatcttaattttgttaca
atagatcaaatattcagtagatgtttaggtttgccgaataccggaatttttggtttatat
gatttaataggtcatgacgtaatgaagttgatatcaagttcattaatttctgctttacct
aaaagtgatgattatcataggatatatactaataccaaagtgtttgataagatgatagag
cataatttaattggacgtaaaggtgagggtggattttatcgtttatctgtatcaaatggt
aagaagattaaagaagtgattaatataagtgatttatcatatcaccctgttcaaaaagta
gatatttcgtttaatagtctcaatgagttgctatctagcaattcaatttatggtaagttt
tttagtgagattattacagaattttatatttatttaacaagtttagtaccatccgtgact
aataatatctacgatatcgataccactatgaagcttggttatagttggcattatggaccg
tttgagttattgactatagctgttaaaaatggatggaatttgataattaaaaatgctgat
ttaatgaatattccactgcctaaatatttagctagtaaagaatatcaaaaaattgataaa
caaaaatttaattctaaaaaagattttttacaagaaagtaaaatagtattatcgaatgat
tctgcaaatttaatacattattgtgagaatttagtatttgttattactacgaaaatgaat
agtttaaatcataacgtattttacttattgcaagaagccgtaagtaaagcagaaaattat
ggaaaaaatctttatatttatccacaaggaaataatttttctgcaggtgcggatttaaag
cttattctttcttatattcaagatgggaattttcataatttagagaatttactaaagctt
ggacaacaaacaatgcgttatttaaaatattcttcggtacatattattagctgtgctcgt
ggtgttgcacttggaggcgggtgtgaacttctattgaactcaagctatattgtagcaaat
caggagcttaatgctggacttatagagcttggagtaggtttaataccaggatggaccggt
gttacagaaatgtttgcccgaagtaatggaaataaaactaaattaattagaaatattaag
aatattatagagcaaaataaaacaagttcagctgattattttaaagcagattatggtata
aagaatatgcaagtcaatatgaacaagcattatattttagatgacgctttgaaactcaga
atatctaaaaaaatagtctccataccgaataaaattactttacctaaaattaatatagtt
agtgaaatagatacatcaaaatataacgagctacaaaataaggtacttaataaatttcag
aatattattgataaacataatgaaataagtgaagcagaattactgacatatgagcgtgaa
atgtttttagaacttgcaaaaacaccacaaactatagagaaattgcaagcgattgtgggg
taa

DBGET integrated database retrieval system