KEGG   Rickettsia rickettsii Arizona: RPO_00970Help
Entry
RPO_00970         CDS       T01721                                 

Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
rra  Rickettsia rickettsii Arizona
Pathway
rra00020  Citrate cycle (TCA cycle)
rra00190  Oxidative phosphorylation
rra00650  Butanoate metabolism
rra01100  Metabolic pathways
rra01110  Biosynthesis of secondary metabolites
rra01120  Microbial metabolism in diverse environments
rra01130  Biosynthesis of antibiotics
rra01200  Carbon metabolism
Module
rra_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rra_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rra_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rra00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RPO_00970
   00650 Butanoate metabolism
    RPO_00970
  Energy metabolism
   00190 Oxidative phosphorylation
    RPO_00970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt tRNA_anti_2 CybS PAP2 Fumarate_red_D Mem_trans Fumarate_red_C
Motif
Other DBs
NCBI-ProteinID: AFB24457
Position
170507..170884
Genome map
AA seq 125 aa AA seqDB search
MVYDFKAEIVKAKNSGSAKSGSHHWLLQRVTGIILALCSVWLIYFTLTNKNNDINIIMWA
LKKPFNVVALLITVVISLYHAMLGMRVVIEDYISCHKLRNTLIIIVQLFCIVTIVAFVVA
LFYKG
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atggtatatgattttaaagcagaaattgtaaaagcaaaaaatagcggttctgctaaaagc
ggttctcatcattggttattgcagagagtaacggggattatattagctttatgttctgtg
tggctaatatattttacgttaaccaataaaaataatgatataaatattattatgtgggca
cttaaaaagccttttaatgtagtagctttgttaattacggtggttatttcgttgtatcat
gcgatgcttggtatgcgtgtagtaattgaagattatataagttgtcacaaattacgtaat
acattgattataatagtgcaattattttgcattgttactattgtagcttttgtagtagcg
ctgttttataaaggataa

DBGET integrated database retrieval system