KEGG   Rickettsia rickettsii Brazil: RPN_01975Help
Entry
RPN_01975         CDS       T01737                                 

Definition
hypothetical protein
Organism
rrb  Rickettsia rickettsii Brazil
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
322489..323973
Genome map
AA seq 494 aa AA seqDB search
MVKEIDINKLLAQENNALNAILSHVNELCKQNKQLQGLIEIQNETKELEKEHNRSLPWFK
RFVKTVSNVKYILIKSEEQLTNEAIKYNNKILKDIDNKIYNIAEKSAPLKQALQEEIEKS
FKDLTKKDLSKDQRARLSEVFFSYKSKPERFSALHMTNPLQFINAEALEKQFNSLNATKQ
NIQNLISENSNIKELKEIQKQVAEIRAEVPHTFFEKLNNIWQNVKNVFVNNSEQVLAKNK
ESNTRTIRKIDEQLYKTQHKFEELIENKERNIKDIIAKLPDNEELQKIVSNLTNHMASKK
EPILANVSLAKPLENNIPPPPPPPPPLPDSNIPPPPPPPPPLPGNNIPPPPPPPPMAPVK
TLSKAVEATTVKKLENQPRPSIDTSDLMREIAGPKKLKKVEFDPNTGKPVAHSHSKPAQN
VNKPSGLESIFARRVAIEMSDSSSSESDSGNWSDVSVNRNKSKMLKTKGERDAKMTTHAQ
KINNRNSQKPSFVR
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggttaaagaaatagatataaataaattattagcacaagaaaataatgctttaaatgct
atattaagccacgtaaatgaattatgcaagcaaaataagcagttgcaaggtttaatcgaa
atacaaaatgaaactaaagaactagaaaaagaacataatagatcgttgccttggtttaaa
agatttgtaaaaacagtttctaatgtaaagtatattttaataaaaagtgaagaacagtta
acaaatgaagcaataaagtataataataaaatattaaaagatattgataataagatatat
aatatagcggaaaaatctgcacctttaaagcaagcattacaagaagaaatcgaaaaaagt
tttaaggatttaacaaagaaagatttatctaaagatcaaagagcaagattatcggaagta
ttttttagttataagagtaaacctgaaagattctcagctctacatatgacaaatccctta
caattcattaatgctgaagcgctagagaaacaatttaattctttaaatgctacaaaacaa
aacatccaaaatttaatatccgaaaattctaatatcaaagaactgaaagaaatacaaaaa
caggttgctgaaattagagcagaagtacctcatacattttttgaaaaattaaataatatt
tggcaaaatgttaaaaatgtttttgtaaataatagtgagcaggttttagcaaaaaacaaa
gagagtaatactagaacaattagaaagattgatgaacaattatataaaacgcagcataaa
tttgaggaattaattgaaaataaagaaagaaatattaaggatataattgcaaaattacct
gacaatgaggagttacaaaagatagtaagtaaccttacaaatcacatggcttcaaaaaaa
gaaccaatattagcaaatgtgtccctagctaaacctttggaaaataacattccacctcca
cctccaccaccgcctcctttaccggacagtaacattccacctccacctccaccaccgcct
cctttaccgggcaataacattccacctccacctccaccaccgcctatggctccggttaag
acattatctaaggctgtagaagctactacggttaaaaaactggaaaatcaaccacgtcct
tctatagatacttctgatttaatgagagaaatagcagggccaaaaaaactaaaaaaggtt
gaatttgaccctaatacaggaaaaccggttgcacattctcatagtaagcctgctcagaat
gttaacaaacctagtggacttgaatcaattttcgcacgaagagttgctatagagatgagt
gatagtagtagcagtgaaagcgatagtggtaactggagtgatgttagtgttaataggaat
aaatcaaaaatgcttaaaactaaaggagaacgagatgctaaaatgactacgcatgctcaa
aaaattaataataggaactcacaaaaaccatcatttgttagataa

DBGET integrated database retrieval system