KEGG   Rickettsia rickettsii Brazil: RPN_04645Help
Entry
RPN_04645         CDS       T01737                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
rrb  Rickettsia rickettsii Brazil
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:rrb00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(765513..766289)
Genome map
AA seq 258 aa AA seqDB search
MNDNLINALKDLIINTGKIALDIKKAGMLTDIKSDGSVVTNADKEISKIIYQTLQTLTSQ
IAIVCEEQPLPIFSSDTFWLIDPIDGTWSYVNGKSTYTVNIGLIENGFPTIGLIYHPETA
KLYYTDVNGRLKIEQNSKEIFVNNEPKHEELHAVIGFYNSNKATKEFLSKYSFGQINAIG
SSMKLCLIAEGAADIYPKFGQTMEWDIAAGHALIKAGGGNILDTYGQEITYGKESFANPN
FFACSKYWLEREARLHRY
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaatgacaatttaattaatgctttaaaagatttaattattaataccggcaagattgca
ctagatataaaaaaggcaggaatgttgactgatattaaatcagatgggtcagtagtcact
aatgccgataaggaaattagtaaaataatttatcaaactctacaaaccttaacctctcaa
atagctatagtatgtgaagagcagccgctacctatattcagcagtgatactttttggtta
atcgatcctattgatgggacatggagctatgtaaacggtaaaagtacatatacggtcaat
atagggcttattgaaaacggttttccaaccatcggcttgatatatcaccctgaaacagca
aagctatattatactgatgtaaacggtcggttaaaaatcgaacagaattctaaagaaata
tttgttaataatgaacctaaacatgaagagcttcatgcggtaataggtttttataattca
aataaagctactaaagaatttttaagtaagtattcattcggtcaaataaatgcaataggc
agttcaatgaaactatgcttaattgctgaaggagcagctgatatatatccaaaattcggt
caaactatggaatgggacatagcggcaggtcatgctttaattaaagccggcggtggtaat
attttagatacgtatggacaagaaattacttacggtaaagaaagtttcgctaatcctaat
ttttttgcctgtagtaaatattggttggaaagggaggcaaggttgcatagatactag

DBGET integrated database retrieval system