KEGG   Rickettsia rickettsii Brazil: RPN_04940Help
Entry
RPN_04940         CDS       T01737                                 

Definition
pyruvate dehydrogenase e1 component subunit alpha
Orthology
K00161  
pyruvate dehydrogenase E1 component subunit alpha [EC:1.2.4.1]
Organism
rrb  Rickettsia rickettsii Brazil
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:rrb01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rrb00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:rrb00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:rrb00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(815009..815989)
Genome map
AA seq 326 aa AA seqDB search
MDIKLGKYKPTKEEYIKSFKDMLLLRRFEEKCGQLYGMGEIGGFCHLYIGQEAVISAVDM
VKQKGDSTITSYRDHAHIILAGTEPKYVLAELMGRATGCSKGKGGSMHLFNVPHKFYGGH
GIVGAQVPIGTGLAFAEKYNDTHNICFTFLGDGAVNQGQVYEAFNMAALWGLPVVYIIEN
NEYSMGTSVARSTFMRDLYKKGASFGIKGFQLDGMDFKEMYDGSKQAAEYVRENSFPLIL
EVKTYRYRGHSMSDPAKYRSKEEVEQYKERDPLVIIRKTILDNKYVTEADLKAIEQSVKE
IVKEAVEFSENSPLPDEGELYTQVYC
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtggatattaagttaggaaaatataagccgacaaaggaagaatatataaaaagctttaaa
gatatgctcctactgcgtcgttttgaagaaaaatgcggtcagttatacggaatgggagaa
atcggtggtttttgtcatttatatatagggcaagaagcagtaatttctgcagtagatatg
gttaaacaaaaaggtgatagcactattactagctatcgtgaccatgctcatattatttta
gcaggaactgagcctaagtatgttcttgccgagcttatggggcgtgctacaggttgctcg
aaaggtaagggtggctcgatgcatttatttaatgtaccccacaaattttacggtggacac
ggtatagtaggggctcaagtaccgataggtacagggcttgcgtttgctgaaaaatataac
gatacgcataatatctgttttacttttttaggtgacggtgccgttaatcaaggtcaggta
tatgaagcttttaatatggctgctttatggggtttgccggtagtttatattattgaaaat
aacgaatattcgatggggacgtctgtagcacgttctacctttatgcgtgatttatataag
aaaggggcatcgtttgggattaaaggatttcagctagacggtatggattttaaagaaatg
tatgacggctctaagcaagcagccgagtatgttagagaaaatagctttcctctgatatta
gaggtaaaaacttatcgttatcgtgggcattcgatgtccgacccggcaaaatatcgtagt
aaagaagaagttgagcaatataaagagcgtgatccgttggtaataataagaaaaacgata
ctcgacaataaatatgtaaccgaagcggatttaaaagcaatagaacagtcggtaaaagaa
attgtgaaagaagcagtagaattctcagaaaattcaccgctacctgatgaaggggagttg
tatacacaggtgtactgttaa

DBGET integrated database retrieval system