KEGG   Rickettsia rickettsii Brazil: RPN_04940Help
Entry
RPN_04940         CDS       T01737                                 

Definition
pyruvate dehydrogenase e1 component subunit alpha
Orthology
K00161  
pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
rrb  Rickettsia rickettsii Brazil
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rrb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RPN_04940
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPN_04940
   00020 Citrate cycle (TCA cycle)
    RPN_04940
   00620 Pyruvate metabolism
    RPN_04940
Enzymes [BR:rrb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     RPN_04940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(815009..815989)
Genome map
AA seq 326 aa AA seqDB search
MDIKLGKYKPTKEEYIKSFKDMLLLRRFEEKCGQLYGMGEIGGFCHLYIGQEAVISAVDM
VKQKGDSTITSYRDHAHIILAGTEPKYVLAELMGRATGCSKGKGGSMHLFNVPHKFYGGH
GIVGAQVPIGTGLAFAEKYNDTHNICFTFLGDGAVNQGQVYEAFNMAALWGLPVVYIIEN
NEYSMGTSVARSTFMRDLYKKGASFGIKGFQLDGMDFKEMYDGSKQAAEYVRENSFPLIL
EVKTYRYRGHSMSDPAKYRSKEEVEQYKERDPLVIIRKTILDNKYVTEADLKAIEQSVKE
IVKEAVEFSENSPLPDEGELYTQVYC
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtggatattaagttaggaaaatataagccgacaaaggaagaatatataaaaagctttaaa
gatatgctcctactgcgtcgttttgaagaaaaatgcggtcagttatacggaatgggagaa
atcggtggtttttgtcatttatatatagggcaagaagcagtaatttctgcagtagatatg
gttaaacaaaaaggtgatagcactattactagctatcgtgaccatgctcatattatttta
gcaggaactgagcctaagtatgttcttgccgagcttatggggcgtgctacaggttgctcg
aaaggtaagggtggctcgatgcatttatttaatgtaccccacaaattttacggtggacac
ggtatagtaggggctcaagtaccgataggtacagggcttgcgtttgctgaaaaatataac
gatacgcataatatctgttttacttttttaggtgacggtgccgttaatcaaggtcaggta
tatgaagcttttaatatggctgctttatggggtttgccggtagtttatattattgaaaat
aacgaatattcgatggggacgtctgtagcacgttctacctttatgcgtgatttatataag
aaaggggcatcgtttgggattaaaggatttcagctagacggtatggattttaaagaaatg
tatgacggctctaagcaagcagccgagtatgttagagaaaatagctttcctctgatatta
gaggtaaaaacttatcgttatcgtgggcattcgatgtccgacccggcaaaatatcgtagt
aaagaagaagttgagcaatataaagagcgtgatccgttggtaataataagaaaaacgata
ctcgacaataaatatgtaaccgaagcggatttaaaagcaatagaacagtcggtaaaagaa
attgtgaaagaagcagtagaattctcagaaaattcaccgctacctgatgaaggggagttg
tatacacaggtgtactgttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system