KEGG   Rickettsia rickettsii Brazil: RPN_05620Help
Entry
RPN_05620         CDS       T01737                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rrb  Rickettsia rickettsii Brazil
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rrb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RPN_05620
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RPN_05620
  Amino acid metabolism
   00310 Lysine degradation
    RPN_05620
Enzymes [BR:rrb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RPN_05620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
931429..932616
Genome map
AA seq 395 aa AA seqDB search
MRVNIIVPSLGESITEATIAKWYKKEGDSVKTDELLLEIETEKVTLEVHAPCNGTIGKIS
KTDGANVAVGEEIGEINEGASVNTAGTNNESAKAQPVTQPTSEKPAVANNTLAPSVQKLV
TENKLDPNNIKGTGRDGRITKGDVLATINTTTTSAPAISKSNEERVQRVRMSRLRKTIAQ
RLKDSQNTAAILTTFNEIDMSKVIALRNQYKEEFEKKHTVKLGFMSFFVKATIEALKLIP
SVNAEIDGDDLVYKNYYDIGVAVGTEQGLVVPVVRDADKMGFAEVEKTIGILAKQAREGK
LSMADLSGGTFSISNGGVYGSLLSTPIINPPQSGILGLHKTEERAVVIDGKIEIRPMMYI
ALSYDHRIIDGKEGVSFLVKIKQLIENPEKLLLNL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgagagttaacattatagtaccgtcgcttggggagtccataacggaagcaactattgcc
aaatggtataagaaagaaggcgattcggttaaaaccgatgaattactgttagaaatcgaa
accgaaaaagtgactttagaagttcatgctccttgcaatggtactataggtaaaatatcg
aaaactgacggtgcaaatgtagcagttggcgaagaaataggcgaaataaatgaaggagca
tctgtaaatactgccggtactaataatgaatctgctaaagctcaaccagtaacacaacct
acttcagaaaaacctgccgtggctaataatactcttgctccttctgtacaaaaattagtt
accgaaaataagcttgaccccaataatataaaaggaacaggtagagatggtagaattacc
aaaggtgacgtgcttgcaacaataaacactacgactacttctgctcctgcaataagtaaa
tctaatgaagaaagagtgcagcgtgttcgtatgtcacgcttgcgtaaaactattgcacag
cgtttaaaagattcacaaaatacagcagctattttgactacttttaatgaaatcgatatg
tcaaaagtaattgctttgcgtaatcaatataaagaagagtttgagaaaaagcacactgtg
aaacttgggtttatgtctttctttgttaaagcaacaattgaagctttaaagcttattccg
tcggtaaatgctgaaatagatggcgatgatttagtatataaaaattactatgatataggt
gtagctgtcggaacagagcaagggcttgttgtaccggttgttagggatgccgataaaatg
ggatttgccgaagtggagaaaactataggaattttggctaaacaagctcgtgagggtaag
ctttctatggctgatttgtcaggtgggacattctcgatttctaacggaggcgtatatggc
tcattattatctacaccgattattaatcctcctcaatcaggtattctaggcttacataaa
accgaggaaagagctgtagttatagacggtaaaattgaaatacgtccgatgatgtatata
gctttatcttacgatcatcgtataattgatgggaaagaaggagtatcgttcttggtaaaa
attaagcagcttattgagaatcctgaaaagttattgttaaatttgtaa

DBGET integrated database retrieval system