KEGG   Rickettsia rickettsii Brazil: RPN_05930Help
Entry
RPN_05930         CDS       T01737                                 

Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
rrb  Rickettsia rickettsii Brazil
Pathway
rrb00020  Citrate cycle (TCA cycle)
rrb00190  Oxidative phosphorylation
rrb00650  Butanoate metabolism
rrb01100  Metabolic pathways
rrb01110  Biosynthesis of secondary metabolites
rrb01120  Microbial metabolism in diverse environments
rrb01130  Biosynthesis of antibiotics
rrb01200  Carbon metabolism
Module
rrb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rrb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rrb_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rrb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RPN_05930
   00650 Butanoate metabolism
    RPN_05930
  Energy metabolism
   00190 Oxidative phosphorylation
    RPN_05930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt tRNA_anti_2 CybS PAP2 Fumarate_red_D Mem_trans Fumarate_red_C
Motif
Other DBs
NCBI-ProteinID: AFB22659
Position
complement(998180..998557)
Genome map
AA seq 125 aa AA seqDB search
MVYDFKAEIVKAKNSGSAKSGSHHWLLQRVTGIILALCSVWLIYFTLTNKNNDINIIMWA
LKKPFNVVALLITVVISLYHAMLGMRVVIEDYISCHKLRNTLIIIVQLFCIVTIVAFVVA
LFYKG
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atggtatatgattttaaagcagaaattgtaaaagcaaaaaatagcggttctgctaaaagc
ggttctcatcattggttattgcagagagtaacggggattatattagctttatgttctgtg
tggctaatatattttacgttaaccaataaaaataatgatataaatattattatgtgggca
cttaaaaagccttttaatgtagtagctttgttaattacggtggttatttcgttgtatcat
gcgatgcttggtatgcgtgtagtaattgaagattatataagttgtcacaaattacgtaat
acattgattataatagtgcaattattttgcattgttactattgtagcttttgtagtagcg
ctgttttataaaggataa

DBGET integrated database retrieval system