KEGG   Rickettsia rickettsii Brazil: RPN_06675Help
Entry
RPN_06675         CDS       T01737                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
rrb  Rickettsia rickettsii Brazil
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rrb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RPN_06675
   00670 One carbon pool by folate
    RPN_06675
Enzymes [BR:rrb01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     RPN_06675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1131679..1132173
Genome map
AA seq 164 aa AA seqDB search
MKNRKIIGIMACDPQGVIGNKGQMPWSYTKEFEYFYQTVKNNIIVMGRKTFDSRPTKILK
NCICIVFSRNTPLQSYNNIFFIKSLDDFWQVIKPFTDKKIFMVGGTEIATLFLEQNLIDE
FLLTKINKNYDGDTFLPLNLLAEWHSVIIDKTNNYQIYKFTKRR
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatagaaaaatcatcggtataatggcatgtgacccacaaggggtgataggtaat
aaaggtcagatgccttggtcttatactaaggagtttgaatatttttatcagacggtaaaa
aataatattatagtcatgggacgaaaaacctttgactctagacccacaaagattttaaaa
aattgtatttgtattgttttttcaagaaatacaccattacaatcttataataatatattt
tttattaaatccttagatgatttttggcaggtaataaaaccttttactgataaaaaaatt
tttatggttggagggacagaaatagcaactcttttcctagaacaaaatcttattgatgaa
tttttacttacaaaaataaataaaaattatgatggagatacttttttgcctcttaatctt
ttagcagaatggcattctgtaataatagataaaacaaacaattatcagatttataaattt
actaagaggaggtaa

DBGET integrated database retrieval system